Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ICMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Rabbit ICMT Polyclonal Antibody | anti-ICMT antibody

ICMT antibody - middle region

Gene Names
ICMT; PCMT; PPMT; PCCMT; HSTE14; MST098; MSTP098
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ICMT; Polyclonal Antibody; ICMT antibody - middle region; anti-ICMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI
Sequence Length
284
Applicable Applications for anti-ICMT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ICMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ICMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-ICMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-ICMT antibody
This is a rabbit polyclonal antibody against ICMT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ICMT is the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined.
Product Categories/Family for anti-ICMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
protein-S-isoprenylcysteine O-methyltransferase
NCBI Official Synonym Full Names
isoprenylcysteine carboxyl methyltransferase
NCBI Official Symbol
ICMT
NCBI Official Synonym Symbols
PCMT; PPMT; PCCMT; HSTE14; MST098; MSTP098
NCBI Protein Information
protein-S-isoprenylcysteine O-methyltransferase
UniProt Protein Name
Protein-S-isoprenylcysteine O-methyltransferase
UniProt Gene Name
ICMT
UniProt Synonym Gene Names
PCCMT; PPMT; pcCMT

NCBI Description

This gene encodes the third of three enzymes that posttranslationally modify isoprenylated C-terminal cysteine residues in certain proteins and target those proteins to the cell membrane. This enzyme localizes to the endoplasmic reticulum. Alternative splicing may result in other transcript variants, but the biological validity of those transcripts has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

ICMT: Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues. Belongs to the isoprenylcysteine O-methyltransferase family.

Protein type: EC 2.1.1.100; Endoplasmic reticulum; Membrane protein, integral; Membrane protein, multi-pass; Methyltransferase; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 1p36.31

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; integral component of membrane; membrane

Molecular Function: protein C-terminal carboxyl O-methyltransferase activity; protein-S-isoprenylcysteine O-methyltransferase activity

Biological Process: C-terminal protein methylation; cellular protein modification process; post-translational protein modification; protein targeting to membrane

Research Articles on ICMT

Similar Products

Product Notes

The ICMT icmt (Catalog #AAA3208378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ICMT antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ICMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ICMT icmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSNFNHVVQN EKSDTHTLVT SGVYAWFRHP SYVGWFYWSI GTQVMLCNPI. It is sometimes possible for the material contained within the vial of "ICMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.