Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ICK rabbit polyclonal antibody. Western Blot analysis of ICK expression in human placenta.)

Rabbit anti-Human ICK Polyclonal Antibody | anti-ICK antibody

ICK (Intestinal Cell Kinase, hICK, ECO, KIAA0936, Laryngeal Cancer Kinase 2, LCK2, MAK-related Kinase, MRK, MGC46090, Serine/Threonine-protein Kinase ICK) (PE)

Gene Names
CILK1; ECO; ICK; MRK; LCK2; hICK; EJM10
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ICK; Polyclonal Antibody; ICK (Intestinal Cell Kinase; hICK; ECO; KIAA0936; Laryngeal Cancer Kinase 2; LCK2; MAK-related Kinase; MRK; MGC46090; Serine/Threonine-protein Kinase ICK) (PE); anti-ICK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ICK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
6095
Applicable Applications for anti-ICK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ICK, aa1-632 (NP_055735.1).
Immunogen Sequence
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ICK rabbit polyclonal antibody. Western Blot analysis of ICK expression in human placenta.)

Western Blot (WB) (ICK rabbit polyclonal antibody. Western Blot analysis of ICK expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of ICK expression in transfected 293T cell line by ICK polyclonal antibody. Lane 1: ICK transfected lysate (71.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ICK expression in transfected 293T cell line by ICK polyclonal antibody. Lane 1: ICK transfected lysate (71.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ICK antibody
Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. ICK is an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation.
Product Categories/Family for anti-ICK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens intestinal cell (MAK-like) kinase (ICK), transcript variant 1, mRNA
NCBI Official Synonym Full Names
ciliogenesis associated kinase 1
NCBI Official Symbol
CILK1
NCBI Official Synonym Symbols
ECO; ICK; MRK; LCK2; hICK; EJM10
NCBI Protein Information
serine/threonine-protein kinase ICK

NCBI Description

Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on ICK

Similar Products

Product Notes

The ICK (Catalog #AAA6381990) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ICK (Intestinal Cell Kinase, hICK, ECO, KIAA0936, Laryngeal Cancer Kinase 2, LCK2, MAK-related Kinase, MRK, MGC46090, Serine/Threonine-protein Kinase ICK) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ICK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ICK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ICK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.