Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HYAL3 rabbit polyclonal antibody. Western Blot analysis of HYAL3 expression in mouse liver.)

Rabbit anti-Human, Mouse HYAL3 Polyclonal Antibody | anti-HYAL3 antibody

HYAL3 (Hyaluronidase 3, Hyaluronidase-3, Hyal-3, Hyaluronoglucosaminidase-3, Lung Carcinoma Protein 3, LuCa-3, LUCA3) (Biotin)

Gene Names
HYAL3; LUCA3; HYAL-3; LUCA-3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HYAL3; Polyclonal Antibody; HYAL3 (Hyaluronidase 3; Hyaluronidase-3; Hyal-3; Hyaluronoglucosaminidase-3; Lung Carcinoma Protein 3; LuCa-3; LUCA3) (Biotin); anti-HYAL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HYAL3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1862
Applicable Applications for anti-HYAL3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HYAL3, aa1-417 (AAH05896.1).
Immunogen Sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HYAL3 rabbit polyclonal antibody. Western Blot analysis of HYAL3 expression in mouse liver.)

Western Blot (WB) (HYAL3 rabbit polyclonal antibody. Western Blot analysis of HYAL3 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of HYAL3 expression in transfected 293T cell line by HYAL3 polyclonal antibody. Lane 1: HYAL3 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HYAL3 expression in transfected 293T cell line by HYAL3 polyclonal antibody. Lane 1: HYAL3 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HYAL3 antibody
This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression.
Product Categories/Family for anti-HYAL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens hyaluronoglucosaminidase 3, mRNA
NCBI Official Synonym Full Names
hyaluronidase 3
NCBI Official Symbol
HYAL3
NCBI Official Synonym Symbols
LUCA3; HYAL-3; LUCA-3
NCBI Protein Information
hyaluronidase-3

NCBI Description

This gene encodes a member of the hyaluronidase family. Hyaluronidases are endoglycosidase enzymes that degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. The regulated turnover of hyaluronan plays a critical role in many biological processes including cell proliferation, migration and differentiation. The encoded protein may also play an important role in sperm function. This gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression, and the expression of specific transcript variants may be indicative of tumor status. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and some isoforms may lack hyaluronidase activity. This gene overlaps and is on the same strand as N-acetyltransferase 6 (GCN5-related), and some transcripts of each gene share a portion of the first exon. [provided by RefSeq, Jan 2011]

Research Articles on HYAL3

Similar Products

Product Notes

The HYAL3 (Catalog #AAA6381916) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HYAL3 (Hyaluronidase 3, Hyaluronidase-3, Hyal-3, Hyaluronoglucosaminidase-3, Lung Carcinoma Protein 3, LuCa-3, LUCA3) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HYAL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HYAL3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HYAL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.