Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit HTRA2 Polyclonal Antibody | anti-HTRA2 antibody

HTRA2 Polyclonal Antibody

Gene Names
HTRA2; OMI; MGCA8; PARK13; PRSS25
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
HTRA2; Polyclonal Antibody; HTRA2 Polyclonal Antibody; MGCA8; OMI; PARK13; PRSS25; anti-HTRA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
PSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Sequence Length
436
Applicable Applications for anti-HTRA2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human HTRA2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Mitochondrion intermembrane space, Mitochondrion membrane, Single-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-HTRA2 antibody
This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-HTRA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa/39kDa/46kDa/48kDa
NCBI Official Full Name
serine protease HTRA2, mitochondrial isoform 3 preproprotein
NCBI Official Synonym Full Names
HtrA serine peptidase 2
NCBI Official Symbol
HTRA2
NCBI Official Synonym Symbols
OMI; MGCA8; PARK13; PRSS25
NCBI Protein Information
serine protease HTRA2, mitochondrial
UniProt Protein Name
Serine protease HTRA2, mitochondrial
Protein Family
UniProt Gene Name
HTRA2
UniProt Synonym Gene Names
OMI; PRSS25; HtrA2

NCBI Description

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

Uniprot Description

Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Cleaves THAP5 and promotes its degradation during apoptosis. Isoform 2 seems to be proteolytically inactive.

Research Articles on HTRA2

Similar Products

Product Notes

The HTRA2 htra2 (Catalog #AAA9134869) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTRA2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTRA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the HTRA2 htra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSDRLREFLH RGEKKNSSSG ISGSQRRYIG VMMLTLSPSI LAELQLREPS FPDVQHGVLI HKVILGSPAH RAGLRPGDVI LAIGEQMVQN AEDVYEAVRT QSQLAVQIRR GRETLTLYVT PEVTE. It is sometimes possible for the material contained within the vial of "HTRA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.