Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HTR4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)

Rabbit HTR4 Polyclonal Antibody | anti-HTR4 antibody

HTR4 antibody - middle region

Gene Names
HTR4; 5-HT4; 5-HT4R
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HTR4; Polyclonal Antibody; HTR4 antibody - middle region; anti-HTR4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA
Sequence Length
388
Applicable Applications for anti-HTR4 antibody
Western Blot (WB)
Homology
Cow: 88%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HTR4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HTR4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-HTR4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)
Related Product Information for anti-HTR4 antibody
This is a rabbit polyclonal antibody against HTR4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HTR4 is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The protein is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined.This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 4 isoform b
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 4
NCBI Official Symbol
HTR4
NCBI Official Synonym Symbols
5-HT4; 5-HT4R
NCBI Protein Information
5-hydroxytryptamine receptor 4
UniProt Protein Name
5-hydroxytryptamine receptor 4
Protein Family
UniProt Gene Name
HTR4
UniProt Synonym Gene Names
5-HT-4; 5-HT4
UniProt Entry Name
5HT4R_HUMAN

NCBI Description

This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described. [provided by RefSeq, May 2010]

Uniprot Description

5-HT(4): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q31-q33

Cellular Component: membrane; integral to plasma membrane; cytoplasm; plasma membrane; endosome

Molecular Function: serotonin receptor activity

Biological Process: synaptic transmission; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; positive regulation of cell proliferation; regulation of appetite; serotonin receptor signaling pathway

Research Articles on HTR4

Similar Products

Product Notes

The HTR4 htr4 (Catalog #AAA3224472) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR4 antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTR4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTR4 htr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCWVIPTFIS FLPIMQGWNN IGIIDLIEKR KFNQNSNSTY CVFMVNKPYA. It is sometimes possible for the material contained within the vial of "HTR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.