Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA19361_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of THP-1 cells using anti-Ku70 antibody (AAA19361).Overlay histogram showing THP-1 cells stained with AAA19361 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Ku70 Antibody (AAA19361, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse anti-Human Ku70 Monoclonal Antibody | anti-XRCC6 antibody

Anti-Ku70 Antibody (monoclonal, 9B6)

Gene Names
XRCC6; ML8; KU70; TLAA; CTC75; CTCBF; G22P1
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Ku70, Antibody; Anti-Ku70 Antibody (monoclonal, 9B6); 5''-deoxyribose-5-phosphate lyase Ku70 antibody; 5''-dRP lyase Ku70 antibody; 70 kDa subunit of Ku antigen antibody; ATP dependent DNA helicase 2 subunit 1 antibody; ATP dependent DNA helicase II 70 kDa subunit antibody; ATP-dependent DNA helicase 2 subunit 1 antibody; ATP-dependent DNA helicase II 70 kDa subunit antibody; CTC box binding factor 75 kDa subunit antibody; CTC box-binding factor 75 kDa subunit antibody; CTC75 antibody; CTCBF antibody; DNA repair protein XRCC6 antibody; G22P1 antibody; Ku 70 antibody; Ku autoantigen 70kDa antibody; Ku autoantigen p70 subunit antibody; Ku autoantigen, 70kDa antibody; Ku p70 antibody; Ku70 antibody; Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa antibody; Kup70 antibody; Lupus Ku autoantigen protein p70 antibody; ML8 antibody; Thyroid autoantigen 70kD (Ku antigen) antibody; Thyroid autoantigen antibody; Thyroid lupus autoantigen antibody; Thyroid lupus autoantigen p70 antibody; Thyroid-lupus autoantigen antibody; TLAA antibody; X ray repair complementing defective repair in Chinese hamster cells 6 antibody; X-ray repair complementing defective repair in Chinese hamster cells 6 antibody; X-ray repair cross-complementing protein 6 antibody; XRCC 6 antibody; XRCC6 antibody; XRCC6_HUMAN antibody; X-ray repair complementing defective repair in Chinese hamster cells 6; anti-XRCC6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
9B6
Specificity
Mouse IgG monoclonal antibody for Ku70 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-XRCC6 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM)
Application Notes
WB: 0.25-0.5ug/ml|Human|
IHC-P: 2-5ug/ml|Human|
ICC/IF: 5ug/ml|Human|
FC/FACS/FCM: 1-3ug/1x106 cells|Human|
Immunogen
A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of THP-1 cells using anti-Ku70 antibody (AAA19361).Overlay histogram showing THP-1 cells stained with AAA19361 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Ku70 Antibody (AAA19361, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19361_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of THP-1 cells using anti-Ku70 antibody (AAA19361).Overlay histogram showing THP-1 cells stained with AAA19361 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Ku70 Antibody (AAA19361, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 6. IF analysis of Ku70 using anti- Ku70 antibody (AAA19361).Ku70 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- Ku70 Antibody (AAA19361) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19361_IF6.jpg IF (Immunofluorescence) (Figure 6. IF analysis of Ku70 using anti- Ku70 antibody (AAA19361).Ku70 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- Ku70 Antibody (AAA19361) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human ovarian serous adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19361_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human ovarian serous adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19361_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human lymphoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19361_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human lymphoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19361_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of Ku70 using anti-Ku70 antibody (AAA19361).Ku70 was detected in paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Ku70 Antibody (AAA19361) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Ku70 using anti-Ku70 antibody (AAA19361).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.Lane 1: human Hela whole cell lysatesLane 2: human A549 whole cell lysatesLane 3: human HepG2 whole cell lysatesLane 4: human MCF-7 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- Ku70 antigen affinity purified monoclonal antibody (Catalog # AAA19361) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Ku70 at approximately 70KD. The expected band size for Ku70 is at 70KD.)

product-image-AAA19361_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of Ku70 using anti-Ku70 antibody (AAA19361).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.Lane 1: human Hela whole cell lysatesLane 2: human A549 whole cell lysatesLane 3: human HepG2 whole cell lysatesLane 4: human MCF-7 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- Ku70 antigen affinity purified monoclonal antibody (Catalog # AAA19361) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Ku70 at approximately 70KD. The expected band size for Ku70 is at 70KD.)
Related Product Information for anti-XRCC6 antibody
XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13. 2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
References
1. Baumann, P., West, S. C. DNA end-joining catalyzed by human cell-free extracts. Proc. Nat. Acad. Sci. 95: 14066- 14070, 1998.
2. Chan, J. Y. C., Lerman, M. I., Prabhakar, B. S., Isozaki, O., Santisteban, P., Kuppers, R. C., Oates, E. L., Notkins, A. L., Kohn, L. D. Cloning and characterization of a cDNA that encodes a 70-kDa novel human thyroid autoantigen. J. Biol. Chem. 264: 3651-3654, 1989.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,843 Da
NCBI Official Full Name
X-ray repair cross-complementing protein 6
NCBI Official Synonym Full Names
X-ray repair complementing defective repair in Chinese hamster cells 6
NCBI Official Symbol
XRCC6
NCBI Official Synonym Symbols
ML8; KU70; TLAA; CTC75; CTCBF; G22P1
NCBI Protein Information
X-ray repair cross-complementing protein 6; 5'-dRP lyase Ku70; Ku autoantigen, 70kDa; DNA repair protein XRCC6; Ku autoantigen p70 subunit; 70 kDa subunit of Ku antigen; thyroid-lupus autoantigen p70; lupus Ku autoantigen protein p70; 5'-deoxyribose-5-pho
UniProt Protein Name
X-ray repair cross-complementing protein 6
UniProt Gene Name
XRCC6
UniProt Synonym Gene Names
G22P1; 5'-dRP lyase Ku70; CTC75; CTCBF; Ku70; TLAA
UniProt Entry Name
XRCC6_HUMAN

Similar Products

Product Notes

The XRCC6 xrcc6 (Catalog #AAA19361) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Ku70 Antibody (monoclonal, 9B6) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Ku70 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM). WB: 0.25-0.5ug/ml|Human| IHC-P: 2-5ug/ml|Human| ICC/IF: 5ug/ml|Human| FC/FACS/FCM: 1-3ug/1x106 cells|Human|. Researchers should empirically determine the suitability of the XRCC6 xrcc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ku70, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.