Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HTN1 expression in transfected 293T cell line by HTN1 polyclonal antibody. Lane 1: HTN1 transfected lysate (6.27kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human HTN1 Polyclonal Antibody | anti-HTN1 antibody

HTN1 (Histatin-1, Histidine-rich Protein 1, Post-PB Protein, PPB, HIS1)

Gene Names
HTN1; HIS1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HTN1; Polyclonal Antibody; HTN1 (Histatin-1; Histidine-rich Protein 1; Post-PB Protein; PPB; HIS1); Anti -HTN1 (Histatin-1; anti-HTN1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HTN1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Applicable Applications for anti-HTN1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HTN1, aa1-57 (NP_002150.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HTN1 expression in transfected 293T cell line by HTN1 polyclonal antibody. Lane 1: HTN1 transfected lysate (6.27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HTN1 expression in transfected 293T cell line by HTN1 polyclonal antibody. Lane 1: HTN1 transfected lysate (6.27kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HTN1 antibody
Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities.
Product Categories/Family for anti-HTN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,963 Da
NCBI Official Full Name
histatin-1
NCBI Official Synonym Full Names
histatin 1
NCBI Official Symbol
HTN1
NCBI Official Synonym Symbols
HIS1
NCBI Protein Information
histatin-1; PPB; post-PB protein; histidine-rich protein 1
UniProt Protein Name
Histatin-1
Protein Family
UniProt Gene Name
HTN1
UniProt Synonym Gene Names
HIS1; PPB; His1 31/57; His1 12/38
UniProt Entry Name
HIS1_HUMAN

NCBI Description

This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. [provided by RefSeq, Aug 2014]

Uniprot Description

HTN1: Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. Belongs to the histatin/statherin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q13

Cellular Component: extracellular region

Molecular Function: protein binding

Biological Process: killing of cells of another organism; biomineral formation; defense response to bacterium; defense response to fungus

Research Articles on HTN1

Similar Products

Product Notes

The HTN1 htn1 (Catalog #AAA6007219) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HTN1 (Histatin-1, Histidine-rich Protein 1, Post-PB Protein, PPB, HIS1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HTN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HTN1 htn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKFFVFALVL ALMISMISAD SHEKRHHGYR RKFHEKHHSH REFPFYGDYG SNYLYDN. It is sometimes possible for the material contained within the vial of "HTN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.