Western Blot (WB)
(WB Suggested Anti-HSPB6 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Rabbit HSPB6 Polyclonal Antibody | anti-HSPB6 antibody
HSPB6 antibody - middle region
Gene Names
HSPB6; HEL55; Hsp20; PPP1R91
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
HSPB6; Polyclonal Antibody; HSPB6 antibody - middle region; anti-HSPB6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
Sequence Length
160
Applicable Applications for anti-HSPB6 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 79%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HSPB6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HSPB6 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-HSPB6 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-HSPB6 antibody
This is a rabbit polyclonal antibody against HSPB6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin (see MIM 102540) and modulates smooth muscle relaxation (Tessier et al., 2003 [PubMed 12842460]).[supplied by OMIM].
Target Description: HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin (see MIM 102540) and modulates smooth muscle relaxation (Tessier et al., 2003 [PubMed 12842460]).[supplied by OMIM].
Product Categories/Family for anti-HSPB6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
heat shock protein beta-6
NCBI Official Synonym Full Names
heat shock protein family B (small) member 6
NCBI Official Symbol
HSPB6
NCBI Official Synonym Symbols
HEL55; Hsp20; PPP1R91
NCBI Protein Information
heat shock protein beta-6
UniProt Protein Name
Heat shock protein beta-6
Protein Family
UniProt Gene Name
HSPB6
UniProt Synonym Gene Names
HspB6
UniProt Entry Name
HSPB6_HUMAN
NCBI Description
This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. [provided by RefSeq, Jan 2012]
Uniprot Description
HSP20: a small heat shock protein of the HSP20 family.
Protein type: Chaperone; Heat shock protein
Chromosomal Location of Human Ortholog: 19q13.12
Cellular Component: cytoplasm; nucleus
Molecular Function: protein binding; protein homodimerization activity; structural constituent of eye lens
Biological Process: regulation of muscle contraction
Research Articles on HSPB6
Similar Products
Product Notes
The HSPB6 hspb6 (Catalog #AAA3209016) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPB6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HSPB6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSPB6 hspb6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARHEERPDEH GFVAREFHRR YRLPPGVDPA AVTSALSPEG VLSIQAAPAS. It is sometimes possible for the material contained within the vial of "HSPB6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
