Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit HSF2BP Polyclonal Antibody | anti-HSF2BP antibody

HSF2BP antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
HSF2BP; Polyclonal Antibody; HSF2BP antibody - N-terminal region; anti-HSF2BP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE
Sequence Length
334
Applicable Applications for anti-HSF2BP antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSF2BP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )
Related Product Information for anti-HSF2BP antibody
This is a rabbit polyclonal antibody against HSF2BP. It was validated on Western Blot and immunohistochemistry

Target Description: HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
heat shock factor 2-binding protein
NCBI Official Synonym Full Names
heat shock transcription factor 2 binding protein
NCBI Official Symbol
HSF2BP
NCBI Protein Information
heat shock factor 2-binding protein
UniProt Protein Name
Heat shock factor 2-binding protein
UniProt Gene Name
HSF2BP
UniProt Entry Name
HSF2B_HUMAN

NCBI Description

HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq, Jul 2008]

Uniprot Description

HSF2BP: May be involved in modulating HSF2 activation in testis.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: cytosol

Molecular Function: protein binding

Biological Process: spermatogenesis; transcription from RNA polymerase II promoter

Research Articles on HSF2BP

Similar Products

Product Notes

The HSF2BP hsf2bp (Catalog #AAA3202317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSF2BP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSF2BP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HSF2BP hsf2bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RHMGTKEEFV KVRKKDLERL TTEVMQIRDF LPRILNGEVL ESFQKLKIVE. It is sometimes possible for the material contained within the vial of "HSF2BP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.