Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HSF2BP monoclonal antibody. Western Blot analysis of HSF2BP expression in human pancreas.)

Mouse anti-Human HSF2BP Monoclonal Antibody | anti-HSF2BP antibody

HSF2BP (Heat Shock Factor 2-binding Protein) (HRP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSF2BP; Monoclonal Antibody; HSF2BP (Heat Shock Factor 2-binding Protein) (HRP); anti-HSF2BP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C4
Specificity
Recognizes human HSF2BP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HSF2BP antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa231-335 from human HSF2BP (NP_008962) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HSF2BP monoclonal antibody. Western Blot analysis of HSF2BP expression in human pancreas.)

Western Blot (WB) (HSF2BP monoclonal antibody. Western Blot analysis of HSF2BP expression in human pancreas.)

Testing Data

(Detection limit for recombinant GST tagged HSF2BP is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HSF2BP is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-HSF2BP antibody
HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.
Product Categories/Family for anti-HSF2BP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,846 Da
NCBI Official Full Name
heat shock factor 2-binding protein
NCBI Official Synonym Full Names
heat shock transcription factor 2 binding protein
NCBI Official Symbol
HSF2BP
NCBI Protein Information
heat shock factor 2-binding protein
UniProt Protein Name
Heat shock factor 2-binding protein
UniProt Gene Name
HSF2BP
UniProt Entry Name
HSF2B_HUMAN

Uniprot Description

HSF2BP: May be involved in modulating HSF2 activation in testis.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: cytosol

Molecular Function: protein binding

Biological Process: spermatogenesis; transcription from RNA polymerase II promoter

Similar Products

Product Notes

The HSF2BP hsf2bp (Catalog #AAA6152972) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSF2BP (Heat Shock Factor 2-binding Protein) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSF2BP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSF2BP hsf2bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSF2BP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.