Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HSF1 Antibody Titration: 0.0625ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Rabbit HSF1 Polyclonal Antibody | anti-HSF1 antibody

HSF1 antibody - C-terminal region

Gene Names
HSF1; HSTF1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSF1; Polyclonal Antibody; HSF1 antibody - C-terminal region; anti-HSF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Sequence Length
529
Applicable Applications for anti-HSF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HSF1 Antibody Titration: 0.0625ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-HSF1 Antibody Titration: 0.0625ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HSF1 antibody
This is a rabbit polyclonal antibody against HSF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HSF1 is a heat-shock transcription factor. Transcription of heat-shock genes is rapidly induced after temperature stress. Hsp90, by itself and/or associated with multichaperone complexes, is a major repressor of HSF1.HSF1 is a heat-shock transcription factor. Transcription of heat-shock genes is rapidly induced after temperature stress. Hsp90, by itself and/or associated with multichaperone complexes, is a major repressor of HSF1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
heat shock factor protein 1
NCBI Official Synonym Full Names
heat shock transcription factor 1
NCBI Official Symbol
HSF1
NCBI Official Synonym Symbols
HSTF1
NCBI Protein Information
heat shock factor protein 1
UniProt Protein Name
Heat shock factor protein 1
Protein Family
UniProt Gene Name
HSF1
UniProt Synonym Gene Names
HSTF1; HSF 1; HSTF 1
UniProt Entry Name
HSF1_HUMAN

NCBI Description

The product of this gene is a transcription factor that is rapidly induced after temperature stress and binds heat shock promoter elements (HSE). This protein plays a role in the regulation of lifespan. Expression of this gene is repressed by phosphorylation, which promotes binding by heat shock protein 90. [provided by RefSeq, Jul 2017]

Uniprot Description

HSF1: a transcription factor that specifically binds heat shock promoter elements (HSE) and activates transcription. Induced in response to heat, heavy metals, and oxidative stress. In higher eukaryotes, HSF is unable to bind to HSEs unless the cells are stressed. Becomes phosphorylated in response to stress, forming homotrimers that bind DNA and activate transcription. Phosphorylation by PLK1 enhances nuclear translocation, and phosphorylation by CaMKII enhances transactivation. Phosphorylation by GSK3 and ERK1 induces binding by 14-3-3 and sequestration in the cytoplasm. In addition, during attenuation from the heat shock response, HSF1 is repressed by direct binding of Hsp70, HSP40, and HSF binding protein 1 (HSBP1). Four alternatively spliced isoforms have been described.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: nucleoplasm; protein complex; pronucleus; cytoplasm; cytosol

Molecular Function: protein binding; chromatin binding; transcription factor activity

Biological Process: negative regulation of cell proliferation; embryonic placenta development; embryonic process involved in female pregnancy; mRNA transcription; female meiosis; defense response; spermatogenesis; response to lipopolysaccharide; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; positive regulation of multicellular organism growth; negative regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation

Research Articles on HSF1

Similar Products

Product Notes

The HSF1 hsf1 (Catalog #AAA3224586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSF1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSF1 hsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SVDTGSNDLP VLFELGEGSY FSEGDGFAED PTISLLTGSE PPKAKDPTVS. It is sometimes possible for the material contained within the vial of "HSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.