Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human HSD17B3 Polyclonal Antibody | anti-HSD17B3 antibody

HSD17B3 (EDH17B3, Testosterone 17-beta-dehydrogenase 3, 17-beta-hydroxysteroid Dehydrogenase Type 3, Testicular 17-beta-hydroxysteroid Dehydrogenase) (MaxLight 650)

Gene Names
HSD17B3; EDH17B3; SDR12C2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSD17B3; Polyclonal Antibody; HSD17B3 (EDH17B3; Testosterone 17-beta-dehydrogenase 3; 17-beta-hydroxysteroid Dehydrogenase Type 3; Testicular 17-beta-hydroxysteroid Dehydrogenase) (MaxLight 650); anti-HSD17B3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSD17B3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-HSD17B3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HSD17B3, aa1-310 (NP_000188.1).
Immunogen Sequence
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-HSD17B3 antibody
This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia.
Product Categories/Family for anti-HSD17B3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,516 Da
NCBI Official Full Name
testosterone 17-beta-dehydrogenase 3
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 3
NCBI Official Symbol
HSD17B3
NCBI Official Synonym Symbols
EDH17B3; SDR12C2
NCBI Protein Information
testosterone 17-beta-dehydrogenase 3; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2
UniProt Protein Name
Testosterone 17-beta-dehydrogenase 3
UniProt Gene Name
HSD17B3
UniProt Synonym Gene Names
EDH17B3; 17-beta-HSD 3
UniProt Entry Name
DHB3_HUMAN

NCBI Description

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq, Jul 2008]

Uniprot Description

HSD17B3: Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH. Defects in HSD17B3 are the cause of male pseudohermaphrodism with gynecomastia (MPH). These individuals have unambiguous female external genitalia at birth, but fail to menstruate at the time of expected puberty and instead virilize as evidenced by growth of the phallus. Breast development may or may not take place. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Protein type: EC 1.1.1.64; Oxidoreductase; Lipid Metabolism - androgen and estrogen

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle

Molecular Function: testosterone 17-beta-dehydrogenase (NADP+) activity

Biological Process: steroid metabolic process; male genitalia development; androgen biosynthetic process

Disease: 17-beta Hydroxysteroid Dehydrogenase Iii Deficiency

Research Articles on HSD17B3

Similar Products

Product Notes

The HSD17B3 hsd17b3 (Catalog #AAA6381724) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B3 (EDH17B3, Testosterone 17-beta-dehydrogenase 3, 17-beta-hydroxysteroid Dehydrogenase Type 3, Testicular 17-beta-hydroxysteroid Dehydrogenase) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSD17B3 hsd17b3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD17B3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.