Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HSD17B2 rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver.)

Rabbit anti-Human, Mouse HSD17B2 Polyclonal Antibody | anti-HSD17B2 antibody

HSD17B2 (EDH17B2, Estradiol 17-beta-dehydrogenase 2, 17-beta-hydroxysteroid Dehydrogenase Type 2, 20 alpha-hydroxysteroid Dehydrogenase, E2DH, Microsomal 17-beta-hydroxysteroid Dehydrogenase, Testosterone 17-beta-dehydrogenase) (PE)

Gene Names
HSD17B2; HSD17; SDR9C2; EDH17B2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSD17B2; Polyclonal Antibody; HSD17B2 (EDH17B2; Estradiol 17-beta-dehydrogenase 2; 17-beta-hydroxysteroid Dehydrogenase Type 2; 20 alpha-hydroxysteroid Dehydrogenase; E2DH; Microsomal 17-beta-hydroxysteroid Dehydrogenase; Testosterone 17-beta-dehydrogenase) (PE); anti-HSD17B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSD17B2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HSD17B2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HSD17B2, aa1-387 (NP_002144.1).
Immunogen Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(HSD17B2 rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver.)

Western Blot (WB) (HSD17B2 rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in human liver.)

Western Blot (WB)

(HSD17B2 rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in mouse kidney.)

Western Blot (WB) (HSD17B2 rabbit polyclonal antibody. Western Blot analysis of HSD17B2 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of HSD17B2 expression in transfected 293T cell line by HSD17B2 polyclonal antibody. Lane 1: HSD17B2 transfected lysate (42.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSD17B2 expression in transfected 293T cell line by HSD17B2 polyclonal antibody. Lane 1: HSD17B2 transfected lysate (42.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HSD17B2 antibody
HSD17B2 is capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone.HSD17B2 also has 20-alpha-HSD activity. HSD17B2 uses NADH while EDH17B3 uses NADPH.
Product Categories/Family for anti-HSD17B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,785 Da
NCBI Official Full Name
estradiol 17-beta-dehydrogenase 2
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 2
NCBI Official Symbol
HSD17B2
NCBI Official Synonym Symbols
HSD17; SDR9C2; EDH17B2
NCBI Protein Information
estradiol 17-beta-dehydrogenase 2; E2DH; 20-alpha-HSD; 17-beta-HSD 2; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehy
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 2
UniProt Gene Name
HSD17B2
UniProt Synonym Gene Names
EDH17B2; 17-beta-HSD 2
UniProt Entry Name
DHB2_HUMAN

Uniprot Description

HSD17B2: Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH. Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: EC 1.1.1.62; EC 1.1.1.239; Lipid Metabolism - androgen and estrogen; Endoplasmic reticulum; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 16q24.1-q24.2

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: estradiol 17-beta-dehydrogenase activity; 20-alpha-hydroxysteroid dehydrogenase activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity

Biological Process: response to retinoic acid; in utero embryonic development; steroid biosynthetic process; placenta development

Research Articles on HSD17B2

Similar Products

Product Notes

The HSD17B2 hsd17b2 (Catalog #AAA6381715) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B2 (EDH17B2, Estradiol 17-beta-dehydrogenase 2, 17-beta-hydroxysteroid Dehydrogenase Type 2, 20 alpha-hydroxysteroid Dehydrogenase, E2DH, Microsomal 17-beta-hydroxysteroid Dehydrogenase, Testosterone 17-beta-dehydrogenase) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSD17B2 hsd17b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD17B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.