Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HSD17B12 expression in transfected 293T cell line by HSD17B12 polyclonal antibody. Lane 1: HSD17B12 transfected lysate (10.78kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human HSD17B12 Polyclonal Antibody | anti-HSD17B12 antibody

HSD17B12 (Estradiol 17-beta-dehydrogenase 12, 17-beta-hydroxysteroid Dehydrogenase 12, 3-ketoacyl-CoA Reductase)

Gene Names
HSD17B12; KAR; SDR12C1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HSD17B12; Polyclonal Antibody; HSD17B12 (Estradiol 17-beta-dehydrogenase 12; 17-beta-hydroxysteroid Dehydrogenase 12; 3-ketoacyl-CoA Reductase); Anti -HSD17B12 (Estradiol 17-beta-dehydrogenase 12; anti-HSD17B12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HSD17B12.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT
Applicable Applications for anti-HSD17B12 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HSD17B12, aa1-98 (AAH12536.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HSD17B12 expression in transfected 293T cell line by HSD17B12 polyclonal antibody. Lane 1: HSD17B12 transfected lysate (10.78kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HSD17B12 expression in transfected 293T cell line by HSD17B12 polyclonal antibody. Lane 1: HSD17B12 transfected lysate (10.78kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HSD17B12 antibody
The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.
Product Categories/Family for anti-HSD17B12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34,324 Da
NCBI Official Full Name
HSD17B12 protein
NCBI Official Synonym Full Names
hydroxysteroid (17-beta) dehydrogenase 12
NCBI Official Symbol
HSD17B12
NCBI Official Synonym Symbols
KAR; SDR12C1
NCBI Protein Information
estradiol 17-beta-dehydrogenase 12; 17-beta-HSD 12; 17beta-HSD type 12; 3-ketoacyl-CoA reductase; steroid dehydrogenase homolog; 17-beta-hydroxysteroid dehydrogenase 12; short chain dehydrogenase/reductase family 12C, member 1
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 12
UniProt Gene Name
HSD17B12
UniProt Synonym Gene Names
17-beta-HSD 12; KAR
UniProt Entry Name
DHB12_HUMAN

NCBI Description

This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation. [provided by RefSeq, Oct 2011]

Uniprot Description

Function: Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in women. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation. Ref.7 Ref.9

Catalytic activity: 17-beta-estradiol + NAD(P)+ = estrone + NAD(P)H.

Pathway: Steroid biosynthesis; estrogen biosynthesis.Lipid metabolism; fatty acid biosynthesis.

Subunit structure: Interacts with ELOVL1 and LASS2. Ref.10

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.7.

Tissue specificity: Expressed in most tissues tested. Highly expressed in the ovary and mammary. Expressed in platelets. Ref.7 Ref.8 Ref.9

Domain: The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins

By similarity.

Sequence similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Biophysicochemical propertiesKinetic parameters:KM=3.5 µM for estrone Ref.9

Sequence caution: The sequence AK027882 differs from that shown. Reason: Frameshift at position 92.

Research Articles on HSD17B12

Similar Products

Product Notes

The HSD17B12 hsd17b12 (Catalog #AAA645578) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSD17B12 (Estradiol 17-beta-dehydrogenase 12, 17-beta-hydroxysteroid Dehydrogenase 12, 3-ketoacyl-CoA Reductase) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HSD17B12 hsd17b12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESALPAAGF LYWVGAGTVA YLALRISYSL FTALRVWGVG NEAGVGPGLG EWAVVTGSTD GIGKSYAEEL AKHGMKVVLI SRSKDKLDQV SSEISNYT. It is sometimes possible for the material contained within the vial of "HSD17B12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.