Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DHB12Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human HSD17B12 Polyclonal Antibody | anti-HSD17B12 antibody

HSD17B12 Antibody - C-terminal region

Gene Names
HSD17B12; KAR; SDR12C1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSD17B12; Polyclonal Antibody; HSD17B12 Antibody - C-terminal region; anti-HSD17B12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKSTRAHYLKKTK
Sequence Length
312
Applicable Applications for anti-HSD17B12 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHB12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DHB12Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DHB12Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HSD17B12 antibody
This is a rabbit polyclonal antibody against DHB12. It was validated on Western Blot

Target Description: This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation.
Product Categories/Family for anti-HSD17B12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
very-long-chain 3-oxoacyl-CoA reductase
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 12
NCBI Official Symbol
HSD17B12
NCBI Official Synonym Symbols
KAR; SDR12C1
NCBI Protein Information
very-long-chain 3-oxoacyl-CoA reductase
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 12
UniProt Gene Name
HSD17B12
UniProt Synonym Gene Names
17-beta-HSD 12; KAR
UniProt Entry Name
DHB12_HUMAN

NCBI Description

This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation. [provided by RefSeq, Oct 2011]

Uniprot Description

HSD17B12: Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in women. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Protein type: Membrane protein, integral; Oxidoreductase; Lipid Metabolism - androgen and estrogen; EC 1.1.1.62; Lipid Metabolism - unsaturated fatty acid biosynthesis; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: extracellular matrix; endoplasmic reticulum membrane; integral to membrane

Molecular Function: heparin binding; collagen binding; estradiol 17-beta-dehydrogenase activity; protein binding; fibronectin binding

Biological Process: extracellular matrix organization and biogenesis; triacylglycerol biosynthetic process; cellular lipid metabolic process; estrogen biosynthetic process; fatty acid biosynthetic process

Research Articles on HSD17B12

Similar Products

Product Notes

The HSD17B12 hsd17b12 (Catalog #AAA3219747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B12 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSD17B12 hsd17b12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTVGLQSRTN GYLIHALMGS IISNLPSWIY LKIVMNMNKS TRAHYLKKTK. It is sometimes possible for the material contained within the vial of "HSD17B12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.