Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: HSD17B11 Blue: NucleusGene Name:HSD17B11Submitted by:Jonathan Bertin, Endoceutics Inc.)

Rabbit HSD17B11 Polyclonal Antibody | anti-HSD17B11 antibody

HSD17B11 antibody - N-terminal region

Gene Names
HSD17B11; DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Monkey
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HSD17B11; Polyclonal Antibody; HSD17B11 antibody - N-terminal region; anti-HSD17B11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Monkey
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
Sequence Length
300
Applicable Applications for anti-HSD17B11 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: HSD17B11 Blue: NucleusGene Name:HSD17B11Submitted by:Jonathan Bertin, Endoceutics Inc.)

Immunohistochemistry (IHC) (Sample Type: Monkey adrenal glandSample Type :Monkey adrenal glandPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: HSD17B11 Blue: NucleusGene Name:HSD17B11Submitted by:Jonathan Bertin, Endoceutics Inc.)

Immunohistochemistry (IHC)

(Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: HSD17B11 Blue: NucleusGene Name:HSD17B11Submitted by:Jonathan Bertin, Endoceutics Inc.)

Immunohistochemistry (IHC) (Sample Type: Monkey vaginaSample Type :Monkey vaginaPrimary Antibody Dilution :1:25Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Color/Signal Descriptions:Brown: HSD17B11 Blue: NucleusGene Name:HSD17B11Submitted by:Jonathan Bertin, Endoceutics Inc.)
Related Product Information for anti-HSD17B11 antibody
This is a rabbit polyclonal antibody against HSD17B11. It was validated on Western Blot

Target Description: Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).
Product Categories/Family for anti-HSD17B11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
estradiol 17-beta-dehydrogenase 11
NCBI Official Synonym Full Names
hydroxysteroid 17-beta dehydrogenase 11
NCBI Official Symbol
HSD17B11
NCBI Official Synonym Symbols
DHRS8; PAN1B; RETSDR2; SDR16C2; 17BHSD11; 17-BETA-HSD11; 17-BETA-HSDXI
NCBI Protein Information
estradiol 17-beta-dehydrogenase 11
UniProt Protein Name
Estradiol 17-beta-dehydrogenase 11
UniProt Gene Name
HSD17B11
UniProt Synonym Gene Names
DHRS8; PAN1B; 17-beta-HSD 11; 17bHSD11; 17betaHSD11; 17-beta-HSD XI; 17betaHSDXI; CTCL-associated antigen HD-CL-03; retSDR2
UniProt Entry Name
DHB11_HUMAN

NCBI Description

Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones (Brereton et al., 2001 [PubMed 11165019]).[supplied by OMIM, Jun 2009]

Uniprot Description

HSD17B11: Can convert androstan-3-alpha,17-beta-diol (3-alpha- diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor- associated antigen in cutaneous T-cell lymphoma. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.

Protein type: EC 1.1.1.62; Secreted; Oxidoreductase; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: cytoplasm; extracellular region; lipid particle

Molecular Function: estradiol 17-beta-dehydrogenase activity; steroid dehydrogenase activity

Biological Process: steroid biosynthetic process; androgen catabolic process

Research Articles on HSD17B11

Similar Products

Product Notes

The HSD17B11 hsd17b11 (Catalog #AAA3205505) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD17B11 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's HSD17B11 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HSD17B11 hsd17b11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGEIVLITGA GHGIGRLTAY EFAKLKSKLV LWDINKHGLE ETAAKCKGLG. It is sometimes possible for the material contained within the vial of "HSD17B11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.