Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-HS3ST3A1 Polyclonal Antibody)

Rabbit anti-Human HS3ST3A1 Polyclonal Antibody | anti-HS3ST3A1 antibody

HS3ST3A1 Polyclonal Antibody

Gene Names
HS3ST3A1; 3OST3A1; 3-OST-3A
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
HS3ST3A1; Polyclonal Antibody; HS3ST3A1 Polyclonal Antibody; 3-OST-3A; 3OST3A1; heparan sulfate-glucosamine 3-sulfotransferase 3A1; anti-HS3ST3A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.44 mg/ml (varies by lot)
Sequence Length
406
Applicable Applications for anti-HS3ST3A1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human HS3ST3A1 (NP_006033.1).
Immunogen Sequence
ERCQTLSGPVVGLSGGGEEAGAPGGGVLAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT
Positive Samples
U-251MG
Cellular Location
Golgi Apparatus Membrane, Single-Pass Type II Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-HS3ST3A1 Polyclonal Antibody)

Western Blot (WB) (Western blot-HS3ST3A1 Polyclonal Antibody)
Related Product Information for anti-HS3ST3A1 antibody
Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 44kDa
Observed: 45kDa
NCBI Official Full Name
Heparan sulfate glucosamine 3-O-sulfotransferase 3A1
NCBI Official Synonym Full Names
heparan sulfate-glucosamine 3-sulfotransferase 3A1
NCBI Official Symbol
HS3ST3A1
NCBI Official Synonym Symbols
3OST3A1; 3-OST-3A
NCBI Protein Information
heparan sulfate glucosamine 3-O-sulfotransferase 3A1
UniProt Protein Name
Heparan sulfate glucosamine 3-O-sulfotransferase 3A1
UniProt Gene Name
HS3ST3A1
UniProt Synonym Gene Names
3OST3A1; HS3ST3A; 3-OST-3A; Heparan sulfate 3-O-sulfotransferase 3A1; h3-OST-3A
UniProt Entry Name
HS3SA_HUMAN

NCBI Description

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3B1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta. [provided by RefSeq, Dec 2014]

Uniprot Description

HS3ST3A1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to an N- unsubstituted glucosamine linked to a 2-O-sulfo iduronic acid unit on heparan sulfate. Catalyzes the O-sulfation of glucosamine in IdoUA2S-GlcNS and also in IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry. Unlike 3-OST-1, does not convert non- anticoagulant heparan sulfate to anticoagulant heparan sulfate. Belongs to the sulfotransferase 1 family.

Protein type: Membrane protein, integral; Glycan Metabolism - glycosaminoglycan degradation; Glycan Metabolism - heparan sulfate biosynthesis; Transferase; EC 2.8.2.23

Chromosomal Location of Human Ortholog: 17p12

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: sulfotransferase activity; [heparan sulfate]-glucosamine 3-sulfotransferase 3 activity

Biological Process: glycosaminoglycan biosynthetic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; pathogenesis

Research Articles on HS3ST3A1

Similar Products

Product Notes

The HS3ST3A1 hs3st3a1 (Catalog #AAA9140867) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HS3ST3A1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HS3ST3A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the HS3ST3A1 hs3st3a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HS3ST3A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.