Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HRH4 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellHRH4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit anti-Human, Pig HRH4 Polyclonal Antibody | anti-HRH4 antibody

HRH4 antibody - middle region

Gene Names
HRH4; H4; H4R; BG26; HH4R; AXOR35; GPRv53; GPCR105
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HRH4; Polyclonal Antibody; HRH4 antibody - middle region; anti-HRH4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSF
Sequence Length
302
Applicable Applications for anti-HRH4 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HRH4 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellHRH4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-HRH4 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellHRH4 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-HRH4 antibody
This is a rabbit polyclonal antibody against HRH4. It was validated on Western Blot

Target Description: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HRH4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
histamine H4 receptor isoform 2
NCBI Official Synonym Full Names
histamine receptor H4
NCBI Official Symbol
HRH4
NCBI Official Synonym Symbols
H4; H4R; BG26; HH4R; AXOR35; GPRv53; GPCR105
NCBI Protein Information
histamine H4 receptor
Protein Family

NCBI Description

Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Research Articles on HRH4

Similar Products

Product Notes

The HRH4 (Catalog #AAA3216086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HRH4 antibody - middle region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's HRH4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HRH4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRLSSRRSLS ASTEVPASFH SERQRRKSSL MFSSRTKMNS NTIASKMGSF. It is sometimes possible for the material contained within the vial of "HRH4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.