Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RASHSample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human HRAS Polyclonal Antibody | anti-HRAS antibody

HRAS Antibody - C-terminal region

Gene Names
HRAS; CTLO; KRAS; HAMSV; HRAS1; KRAS2; RASH1; RASK2; Ki-Ras; p21ras; C-H-RAS; c-K-ras; H-RASIDX; c-Ki-ras; C-BAS/HAS; C-HA-RAS1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HRAS; Polyclonal Antibody; HRAS Antibody - C-terminal region; anti-HRAS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG
Sequence Length
189
Applicable Applications for anti-HRAS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RASH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RASHSample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RASHSample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HRAS antibody
This is a rabbit polyclonal antibody against RASH. It was validated on Western Blot

Target Description: This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ras protein, partial
NCBI Official Synonym Full Names
HRas proto-oncogene, GTPase
NCBI Official Symbol
HRAS
NCBI Official Synonym Symbols
CTLO; KRAS; HAMSV; HRAS1; KRAS2; RASH1; RASK2; Ki-Ras; p21ras; C-H-RAS; c-K-ras; H-RASIDX; c-Ki-ras; C-BAS/HAS; C-HA-RAS1
NCBI Protein Information
GTPase HRas
UniProt Protein Name
GTPase HRas
Protein Family
UniProt Gene Name
HRAS
UniProt Synonym Gene Names
HRAS1
UniProt Entry Name
RASH_HUMAN

NCBI Description

This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HRas: a small GTPase protein of the Ras family. Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP). Mutations are implicated in a variety of human tumors.

Protein type: Motility/polarity/chemotaxis; G protein, monomeric, Ras; Oncoprotein; G protein; G protein, monomeric

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: Golgi membrane; Golgi apparatus; perinuclear region of cytoplasm; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: protein C-terminus binding; protein binding; GTP binding

Biological Process: regulation of long-term neuronal synaptic plasticity; axon guidance; activation of MAPKK activity; nerve growth factor receptor signaling pathway; protein heterooligomerization; positive regulation of JNK cascade; signal transduction; chemotaxis; negative regulation of cell proliferation; positive regulation of MAP kinase activity; synaptic transmission; cell surface receptor linked signal transduction; positive regulation of MAPKKK cascade; small GTPase mediated signal transduction; positive regulation of cell proliferation; ephrin receptor signaling pathway; visual learning; negative regulation of neuron apoptosis; cell cycle arrest; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; mitotic cell cycle checkpoint; MAPKKK cascade; endocytosis; social behavior; regulation of synaptic transmission, GABAergic; positive regulation of Rac protein signal transduction; cell proliferation; organ morphogenesis; negative regulation of cell differentiation; Ras protein signal transduction; insulin receptor signaling pathway; striated muscle cell differentiation; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis; blood coagulation; leukocyte migration; positive regulation of epithelial cell proliferation; positive regulation of DNA replication; positive regulation of cell migration

Disease: Bladder Cancer; Thyroid Carcinoma, Follicular; Costello Syndrome; Schimmelpenning-feuerstein-mims Syndrome; Melanocytic Nevus Syndrome, Congenital; Nevus, Epidermal

Research Articles on HRAS

Similar Products

Product Notes

The HRAS hras (Catalog #AAA3219889) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HRAS Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HRAS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HRAS hras for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDLARSYGIP YIETSAKTRQ GVEDAFYTLV REIRQHKLRK LNPPDESGPG. It is sometimes possible for the material contained within the vial of "HRAS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.