Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HOXA1 expression in transfected 293T cell line by HOXA1 polyclonal antibody. Lane 1: HOXA1 transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HOXA1 Polyclonal Antibody | anti-HOXA1 antibody

HOXA1 (Homeobox Protein Hox-A1, Homeobox Protein Hox-1F, HOX1F, MGC45232) (AP)

Gene Names
HOXA1; BSAS; HOX1; HOX1F
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOXA1; Polyclonal Antibody; HOXA1 (Homeobox Protein Hox-A1; Homeobox Protein Hox-1F; HOX1F; MGC45232) (AP); anti-HOXA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HOXA1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HOXA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HOXA1, aa1-335 (NP_005513.1).
Immunogen Sequence
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HOXA1 expression in transfected 293T cell line by HOXA1 polyclonal antibody. Lane 1: HOXA1 transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HOXA1 expression in transfected 293T cell line by HOXA1 polyclonal antibody. Lane 1: HOXA1 transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HOXA1 antibody
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments.
Product Categories/Family for anti-HOXA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,641 Da
NCBI Official Full Name
homeobox protein Hox-A1 isoform a
NCBI Official Synonym Full Names
homeobox A1
NCBI Official Symbol
HOXA1
NCBI Official Synonym Symbols
BSAS; HOX1; HOX1F
NCBI Protein Information
homeobox protein Hox-A1; homeobox 1F; homeo box A1; lab-like protein; Hox 1.6-like protein; homeobox protein Hox-1F; HOX A1 homeodomain protein
UniProt Protein Name
Homeobox protein Hox-A1
Protein Family
UniProt Gene Name
HOXA1
UniProt Synonym Gene Names
HOX1F
UniProt Entry Name
HXA1_HUMAN

NCBI Description

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXA1: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures. Seems to act in the maintenance and/or generation of hindbrain segments. Defects in HOXA1 are the cause of Athabaskan brainstem dysgenesis syndrome (ABDS); also known as Narvajo brainstem syndrome. This syndrome is characterized by horizontal gaze palsy, sensorineural deafness, central hypoventilation, and developmental delay. Some patients had swallowing dysfunction, vocal cord paralysis, facial paresis, seizures, and cardiac outflow tract anomalies. Defects in HOXA1 are the cause of Bosley-Salih-Alorainy syndrome (BSAS). Affected individuals show horizontal gaze abnormalities, deafness, facial weakness, vascular malformations of the internal carotid arteries and cardiac outflow trac. Some patients manifest mental retardation and autism spectrum disorder. In contrast to individuals with ABSD, central hypoventilation is not observed in individuals with BSAS. Belongs to the Antp homeobox family. Labial subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: facial nerve structural organization; anatomical structure morphogenesis; central nervous system neuron differentiation; facial nucleus development; transcription, DNA-dependent; multicellular organismal development; neuromuscular process; outer ear morphogenesis; motor axon guidance; rhombomere 4 development; anterior/posterior pattern formation; sensory perception of sound; optokinetic behavior; artery morphogenesis; embryonic neurocranium morphogenesis; positive regulation of transcription from RNA polymerase II promoter; cognition; rhombomere 5 development; inner ear development; rhombomere 3 development; regulation of behavior; abducens nerve formation

Disease: Athabaskan Brainstem Dysgenesis Syndrome

Research Articles on HOXA1

Similar Products

Product Notes

The HOXA1 hoxa1 (Catalog #AAA6381507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXA1 (Homeobox Protein Hox-A1, Homeobox Protein Hox-1F, HOX1F, MGC45232) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOXA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXA1 hoxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.