Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PROX1 is approximately 1ng/ml as a capture antibody.)

Mouse PROX1 Monoclonal Antibody | anti-PROX1 antibody

PROX1 (prospero Homeobox 1) (PE)

Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
PROX1; Monoclonal Antibody; PROX1 (prospero Homeobox 1) (PE); prospero Homeobox 1; anti-PROX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
10000000
Specificity
Recognizes PROX1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PROX1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PROX1 (NP_002754.2, 638aa-737aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PROX1 is approximately 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PROX1 is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PROX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PROX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PROX1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PROX1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-PROX1 antibody
Mouse monoclonal antibody raised against a partial recombinant PROX1.
Product Categories/Family for anti-PROX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,203 Da
NCBI Official Full Name
prospero homeobox protein 1
NCBI Official Synonym Full Names
prospero homeobox 1
NCBI Official Symbol
PROX1
NCBI Protein Information
prospero homeobox protein 1; prospero-related homeobox 1; homeobox prospero-like protein PROX1
UniProt Protein Name
Prospero homeobox protein 1
Protein Family
UniProt Gene Name
PROX1
UniProt Synonym Gene Names
PROX-1
UniProt Entry Name
PROX1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene is conserved across vertebrates and may play an essential role during development. Altered levels of this protein have been reported in cancers of different organs, such as colon, brain, blood, breast, pancreas, liver and esophagus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

PROX1: May play a fundamental role in early development of CNS. May regulate gene expression and development of postmitotic undifferentiated young neurons. Belongs to the Prospero homeobox family.

Protein type: DNA-binding; Transcription factor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; ligand-dependent nuclear receptor binding; protein binding; DBD domain binding; DNA binding; LBD domain binding; transcription factor activity; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; lens development in camera-type eye; circadian rhythm; neural tube development; positive regulation of cyclin-dependent protein kinase activity; ventricular cardiac myofibril development; muscle thin filament assembly; atrial cardiac muscle morphogenesis; positive regulation of transcription, DNA-dependent; cell fate determination; negative regulation of transcription from RNA polymerase II promoter; olfactory placode formation; negative regulation of cell proliferation; venous blood vessel morphogenesis; pancreas development; positive regulation of cell proliferation; lymphangiogenesis; ventricular cardiac muscle morphogenesis; kidney development; response to nutrient levels; dentate gyrus development; negative regulation of transcription factor activity; positive regulation of cell cycle; liver development; regulation of circadian rhythm; cerebellar granule cell differentiation; dorsal spinal cord development; negative regulation of viral genome replication; regulation of gene expression; otic placode formation; embryonic retina morphogenesis in camera-type eye; positive regulation of endothelial cell proliferation; optic placode formation involved in camera-type eye; positive regulation of transcription from RNA polymerase II promoter; brain development; negative regulation of transcription, DNA-dependent; retina morphogenesis in camera-type eye; lung development

Research Articles on PROX1

Similar Products

Product Notes

The PROX1 prox1 (Catalog #AAA6185913) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PROX1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PROX1 prox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PROX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.