Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Recommended HNRPM Antibody Titration: 0.2-1 ug/ml)

Rabbit HNRPM Polyclonal Antibody | anti-HNRPM antibody

HNRPM antibody

Gene Names
HNRNPM; CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
Applications
Western Blot
Purity
Affinity purified
Synonyms
HNRPM; Polyclonal Antibody; HNRPM antibody; Polyclonal HNRPM; Anti-HNRPM; HNRPM4; NAGR1; DKFZp547H118; HNRNPM4; HNRNPM; HTGR1; Heterogeneous Nuclear Ribonucleoprotein M; anti-HNRPM antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
HNRPM antibody was raised against the N terminal Of Hnrpm
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPM antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
595
Applicable Applications for anti-HNRPM antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
Cross-Reactivity
Human
Immunogen
HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Recommended HNRPM Antibody Titration: 0.2-1 ug/ml)

Western Blot (WB) (Recommended HNRPM Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-HNRPM antibody
Rabbit polyclonal HNRPM antibody raised against the N terminal Of Hnrpm
Product Categories/Family for anti-HNRPM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73 kDa (MW of target protein)
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein M isoform c
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein M
NCBI Official Symbol
HNRNPM
NCBI Official Synonym Symbols
CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein M
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein M
UniProt Gene Name
HNRNPM
UniProt Synonym Gene Names
HNRPM; NAGR1; hnRNP M
UniProt Entry Name
HNRPM_HUMAN

NCBI Description

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

hnRNP M: Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Spliceosome; Nucleolus; RNA-binding; Receptor, misc.

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; extracellular matrix; spliceosome; nuclear matrix; membrane; integral to plasma membrane; nucleolus; paraspeckles

Molecular Function: protein domain specific binding; protein binding; RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression

Research Articles on HNRPM

Similar Products

Product Notes

The HNRPM hnrnpm (Catalog #AAA839496) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNRPM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the HNRPM hnrnpm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRPM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.