Rabbit HNRPA0 Polyclonal Antibody | anti-HNRNPA0 antibody

HNRPA0 antibody - middle region

Cat. Num. AAA3205414

• Gene Names: HNRNPA0; HNRPA0
• Reactivity: Cow, Dog, Human, Pig
• Applications: Immunofluorescence, Immunoprecipitation, Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: HNRPA0; Polyclonal Antibody; HNRPA0 antibody - middle region; anti-HNRNPA0 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Human, Pig
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
• Sequence Length: 305

• Applicable Applications for anti-HNRNPA0 antibody: Immunofluorescence (IF), Immunoprecipitation (IP), Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Dog: 93%; Human: 100%; Pig: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type: MCF-7Sample Type :MCF7 cellsPrimary Antibody Dilution :1:200Secondary Antibody:Anti-rabbit-FITCSecondary Antibody Dilution:1:500Color/Signal Descriptions:DAPI: Blue hn-RNPA0: GreenGene Name:HNRPA0Submitted by:Anonymous)

Immunohistochemistry (IHC)

(Rabbit Anti-HNRNPA0 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-HNRPA0 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunoprecipitation (IP)

(Sample Type: K562Amount and Sample Type :Lane 1: 5% InputLane 2: 5% SupLane 3: Normal IgGLane 4: hn-RNPA0 ppt. k562 sampleIP Antibody :HNRPA0Amount of IP Antibody :Primary Antibody :HNRPA0Primary Antibody Dilution:1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name :HNRPA0Submitted by:Anonymous)

Western Blot (WB)

(Sample Type: HeLa S3, MCF7, K562Lanes :Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysatePrimary Antibody Dilution :1:4000Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:5000Gene Name :HNRPA0Submitted by :Anonymous)

Western Blot (WB)

(WB Suggested Anti-HNRPA0 Antibody Titration: 0.625ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Related Product Information for anti-HNRNPA0 antibody

This is a rabbit polyclonal antibody against HNRPA0. It was validated on Western Blot and immunohistochemistry

Target Description: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.

Product Categories/Family for anti-HNRNPA0 antibody

Polyclonal; RNA Binding Proteins; Chromatin & Nuclear Signaling; E3 & Ubiquitin; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 5803036
• NCBI GeneID: 10949
• NCBI Accession #: NP_006796
• NCBI GenBank Nucleotide #: NM_006805
• UniProt Accession #: Q13151
• Molecular Weight: 34kDa
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein A0
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein A0
• NCBI Official Symbol: HNRNPA0
• NCBI Official Synonym Symbols: HNRPA0
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein A0
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein A0
• Protein Family: Heterogeneous nuclear ribonucleoprotein
• UniProt Gene Name: HNRNPA0
• UniProt Synonym Gene Names: HNRPA0; hnRNP A0
• UniProt Entry Name: ROA0_HUMAN

NCBI Description

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP A0: a ubiquitously expressed heterogeneous nuclear ribonucleoprotein (hnRNP) of the A/B subfamily. hnRNPs are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. Has two repeats of RNA recognition motif domains (RRM), followed by a glycine-rich C-terminus.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; ribonucleoprotein complex; nucleus

Molecular Function: RNA binding; nucleotide binding; AU-rich element binding; protein kinase binding

Biological Process: nuclear mRNA splicing, via spliceosome; RNA splicing; response to lipopolysaccharide; gene expression; inflammatory response; mRNA processing