Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-HNF4G Polyclonal Antibody)

Rabbit HNF4G Polyclonal Antibody | anti-HNF4G antibody

HNF4G Polyclonal Antibody

Gene Names
HNF4G; NR2A2; NR2A3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
HNF4G; Polyclonal Antibody; HNF4G Polyclonal Antibody; NR2A2; NR2A3; hepatocyte nuclear factor 4-gamma; anti-HNF4G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.49 mg/ml (varies by lot)
Sequence Length
445
Applicable Applications for anti-HNF4G antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 366-445 of human HNF4G (NP_004124.4).
Immunogen Sequence
ASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Positive Samples
HT-29, Mouse Pancreas, Rat Pancreas, Rat Kidney
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-HNF4G Polyclonal Antibody)

Western Blot (WB) (Western blot-HNF4G Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa; 50kDa
Observed: 50kDa
NCBI Official Full Name
hepatocyte nuclear factor 4-gamma isoform 1
NCBI Official Synonym Full Names
hepatocyte nuclear factor 4 gamma
NCBI Official Symbol
HNF4G
NCBI Official Synonym Symbols
NR2A2; NR2A3
NCBI Protein Information
hepatocyte nuclear factor 4-gamma
UniProt Protein Name
Hepatocyte nuclear factor 4-gamma
Protein Family
UniProt Gene Name
HNF4G
UniProt Synonym Gene Names
NR2A2; HNF-4-gamma
UniProt Entry Name
HNF4G_HUMAN

Uniprot Description

HNF4G: Transcription factor. Has a lower transcription activation potential than HNF4-alpha. Belongs to the nuclear hormone receptor family. NR2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: nucleoplasm

Molecular Function: ligand-dependent nuclear receptor activity; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; positive regulation of transcription, DNA-dependent; steroid hormone mediated signaling; gene expression; endocrine pancreas development

Research Articles on HNF4G

Similar Products

Product Notes

The HNF4G hnf4g (Catalog #AAA9140690) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNF4G Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HNF4G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:100. Researchers should empirically determine the suitability of the HNF4G hnf4g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNF4G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.