Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Small Intestine)

Rabbit HNF4A Polyclonal Antibody | anti-HNF4A antibody

HNF4A antibody - middle region

Gene Names
HNF4A; TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HNF4A; Polyclonal Antibody; HNF4A antibody - middle region; anti-HNF4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV
Sequence Length
452
Applicable Applications for anti-HNF4A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HNF4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Small Intestine)

Immunohistochemistry (IHC) (Human Small Intestine)

Western Blot (WB)

(WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateHNF4A is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB) (WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateHNF4A is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)
Related Product Information for anti-HNF4A antibody
This is a rabbit polyclonal antibody against HNF4A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
hepatocyte nuclear factor 4-alpha isoform 5
NCBI Official Synonym Full Names
hepatocyte nuclear factor 4 alpha
NCBI Official Symbol
HNF4A
NCBI Official Synonym Symbols
TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
NCBI Protein Information
hepatocyte nuclear factor 4-alpha
UniProt Protein Name
Hepatocyte nuclear factor 4-alpha
Protein Family
UniProt Gene Name
HNF4A
UniProt Synonym Gene Names
HNF4; NR2A1; TCF14; HNF-4-alpha; TCF-14
UniProt Entry Name
HNF4A_HUMAN

NCBI Description

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012]

Uniprot Description

HNF4 alpha: a nuclear transcription factor which binds DNA as a homodimer. Controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic gene, alpha 1-antitrypsin, apolipoprotein CIII, and transthyretin genes. May be essential for development of the liver, kidney and intestine. Mutations have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Four alternatively spliced isoforms have been described.

Protein type: Nuclear receptor; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; ligand-dependent nuclear receptor activity; protein homodimerization activity; DNA binding; zinc ion binding; steroid hormone receptor activity; fatty acid binding; transcription factor activity; receptor binding

Biological Process: transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; regulation of lipid metabolic process; positive regulation of transcription, DNA-dependent; lipid homeostasis; glucose homeostasis; endocrine pancreas development; regulation of transcription from RNA polymerase II promoter; negative regulation of cell proliferation; regulation of gastrulation; xenobiotic metabolic process; response to glucose stimulus; ornithine metabolic process; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; gene expression; lipid metabolic process; negative regulation of cell growth; blood coagulation; sex differentiation; regulation of insulin secretion; phospholipid homeostasis

Disease: Fanconi Renotubular Syndrome 4 With Maturity-onset Diabetes Of The Young; Maturity-onset Diabetes Of The Young, Type 1; Diabetes Mellitus, Noninsulin-dependent

Research Articles on HNF4A

Similar Products

Product Notes

The HNF4A hnf4a (Catalog #AAA3201061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNF4A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HNF4A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HNF4A hnf4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGQAATPETP QPSPPGGSGS EPYKLLPGAV ATIVKPLSAI PQPTITKQEV. It is sometimes possible for the material contained within the vial of "HNF4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.