Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Human Hep-2 cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit-Alexa Fluor 568Secondary Antibody Dilution :1:400Color/Signal Descriptions :Red: IMPDH2 Blue: DAPIGene Name :IMPDH2Submitted by :S. John Calise, Edward Chan Lab, University of Florida )

Rabbit IMPDH2 Polyclonal Antibody | anti-IMPDH2 antibody

IMPDH2 antibody - N-terminal region

Gene Names
IMPDH2; IMPD2; IMPDH-II
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
IMPDH2; Polyclonal Antibody; IMPDH2 antibody - N-terminal region; anti-IMPDH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD
Sequence Length
514
Applicable Applications for anti-IMPDH2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IMPDH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human Hep-2 cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit-Alexa Fluor 568Secondary Antibody Dilution :1:400Color/Signal Descriptions :Red: IMPDH2 Blue: DAPIGene Name :IMPDH2Submitted by :S. John Calise, Edward Chan Lab, University of Florida )

Immunohistochemistry (IHC) (Sample Type :Human Hep-2 cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit-Alexa Fluor 568Secondary Antibody Dilution :1:400Color/Signal Descriptions :Red: IMPDH2 Blue: DAPIGene Name :IMPDH2Submitted by :S. John Calise, Edward Chan Lab, University of Florida )

Western Blot (WB)

(WB Suggested Anti-IMPDH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIMPDH2 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-IMPDH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateIMPDH2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-IMPDH2 antibody
This is a rabbit polyclonal antibody against IMPDH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56
NCBI Official Full Name
inosine-5'-monophosphate dehydrogenase 2
NCBI Official Synonym Full Names
inosine monophosphate dehydrogenase 2
NCBI Official Symbol
IMPDH2
NCBI Official Synonym Symbols
IMPD2; IMPDH-II
NCBI Protein Information
inosine-5'-monophosphate dehydrogenase 2
UniProt Protein Name
Inosine-5'-monophosphate dehydrogenase 2
UniProt Gene Name
IMPDH2
UniProt Entry Name
IMDH2_HUMAN

NCBI Description

This gene encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation. [provided by RefSeq, Jul 2008]

Uniprot Description

IMPDH2: a rate limiting enzyme in the de novo synthesis of guanine nucleotides and therefore is involved in the regulation of cell growth. It may also have a role in the development of malignancy and the growth progression of some tumors.

Protein type: Oxidoreductase; EC 1.1.1.205; Xenobiotic Metabolism - drug metabolism - other enzymes; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 3p21.2

Cellular Component: peroxisomal membrane; membrane; cytoplasm; nucleus; cytosol

Molecular Function: DNA binding; RNA binding; metal ion binding; nucleotide binding; IMP dehydrogenase activity

Biological Process: purine ribonucleoside monophosphate biosynthetic process; lymphocyte proliferation; nucleobase, nucleoside and nucleotide metabolic process; retina development in camera-type eye; GMP biosynthetic process; purine base metabolic process; protein homotetramerization

Research Articles on IMPDH2

Similar Products

Product Notes

The IMPDH2 impdh2 (Catalog #AAA3211626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IMPDH2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's IMPDH2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the IMPDH2 impdh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MADYLISGGT SYVPDDGLTA QQLFNCGDGL TYNDFLILPG YIDFTADQVD. It is sometimes possible for the material contained within the vial of "IMPDH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.