Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit anti-Human HMGB4 Polyclonal Antibody | anti-HMGB4 antibody

HMGB4 antibody - C-terminal region

Gene Names
HMGB4; dJ1007G16.5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HMGB4; Polyclonal Antibody; HMGB4 antibody - C-terminal region; anti-HMGB4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG
Sequence Length
186
Applicable Applications for anti-HMGB4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HMGB4 antibody
This is a rabbit polyclonal antibody against HMGB4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.
Product Categories/Family for anti-HMGB4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
high mobility group protein B4 isoform 1
NCBI Official Synonym Full Names
high mobility group box 4
NCBI Official Symbol
HMGB4
NCBI Official Synonym Symbols
dJ1007G16.5
NCBI Protein Information
high mobility group protein B4
UniProt Protein Name
High mobility group protein B4
UniProt Gene Name
HMGB4
UniProt Entry Name
HMGB4_HUMAN

Uniprot Description

HMGB4: Belongs to the HMGB family.

Chromosomal Location of Human Ortholog: 1p35.1

Cellular Component: chromosome; nucleus

Molecular Function: DNA binding; chromatin binding

Biological Process: chromatin remodeling; regulation of transcription, DNA-dependent

Research Articles on HMGB4

Similar Products

Product Notes

The HMGB4 hmgb4 (Catalog #AAA3204878) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGB4 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMGB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMGB4 hmgb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WSTATDLEKH PYEQRVALLR AKYFEELELY RKQCNARKKY RMSARNRCRG. It is sometimes possible for the material contained within the vial of "HMGB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.