Western Blot (WB)
(Host: MouseTarget Name: HMBOX1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Rabbit HMBOX1 Polyclonal Antibody | anti-HMBOX1 antibody
HMBOX1 antibody - N-terminal region
Gene Names
HMBOX1; HOT1; PBHNF; HNF1LA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
HMBOX1; Polyclonal Antibody; HMBOX1 antibody - N-terminal region; anti-HMBOX1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK
Sequence Length
420
Applicable Applications for anti-HMBOX1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HMBOX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: HMBOX1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: HMBOX1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-HMBOX1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-HMBOX1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HMBOX1 antibody
This is a rabbit polyclonal antibody against HMBOX1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: HMBOX1 is located at the boundary of 8p12.3 and 8p21.1. HMBOX1 proteins are highly conserved in human, mouse, rat, chicken and Xenopus laevis. Functional HMBOX1::EGFP (enhanced green fluorescent protein) fusion protein revealed that HMBOX1 accumulated more in cytoplasm than in nucleus. HMBOX1 is a transcription repressor. Human HMBOX1 is widely expressed in 18 tissues, and it is highly expressed in pancreas. Hmbox1 is widely expressed in mouse pancreas and the expression of this gene can also be detected in pallium, hippocampus and hypothalamus.
Target Description: HMBOX1 is located at the boundary of 8p12.3 and 8p21.1. HMBOX1 proteins are highly conserved in human, mouse, rat, chicken and Xenopus laevis. Functional HMBOX1::EGFP (enhanced green fluorescent protein) fusion protein revealed that HMBOX1 accumulated more in cytoplasm than in nucleus. HMBOX1 is a transcription repressor. Human HMBOX1 is widely expressed in 18 tissues, and it is highly expressed in pancreas. Hmbox1 is widely expressed in mouse pancreas and the expression of this gene can also be detected in pallium, hippocampus and hypothalamus.
Product Categories/Family for anti-HMBOX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
homeobox-containing protein 1 isoform 1
NCBI Official Synonym Full Names
homeobox containing 1
NCBI Official Symbol
HMBOX1
NCBI Official Synonym Symbols
HOT1; PBHNF; HNF1LA
NCBI Protein Information
homeobox-containing protein 1
UniProt Protein Name
Homeobox-containing protein 1
Protein Family
UniProt Gene Name
HMBOX1
UniProt Entry Name
HMBX1_HUMAN
Research Articles on HMBOX1
Similar Products
Product Notes
The HMBOX1 hmbox1 (Catalog #AAA3204727) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMBOX1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HMBOX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMBOX1 hmbox1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETMSHYTDEP RFTIEQIDLL QRLRRTGMTK HEILHALETL DRLDQEHSDK. It is sometimes possible for the material contained within the vial of "HMBOX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
