Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-JMJD1B Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)

Rabbit JMJD1B Polyclonal Antibody | anti-KDM3B antibody

JMJD1B antibody - C-terminal region

Gene Names
KDM3B; 5qNCA; NET22; C5orf7; JMJD1B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
JMJD1B; Polyclonal Antibody; JMJD1B antibody - C-terminal region; anti-KDM3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VHNLYSCIKVAEDFVSPEHVKHCFRLTQEFRHLSNTHTNHEDKLQVKNII
Sequence Length
1761
Applicable Applications for anti-KDM3B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-JMJD1B Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-JMJD1B Antibody Titration: 2.5ug/mlELISA Titer: 1:12500Positive Control: Human Thymus)
Related Product Information for anti-KDM3B antibody
This is a rabbit polyclonal antibody against JMJD1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: JMJD1B contains a highly-conserved C-terminus containing a zinc finger with the unique spacing Cys-X2-Cys-X7-His-X2-Cys-X2-Cys-X4-Cys-X2-Cys and a jmjC domain. It plays an important role in histone demethylation and may be a candidate for tumor suppressors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
192kDa
NCBI Official Full Name
Lysine-specific demethylase 3B
NCBI Official Synonym Full Names
lysine demethylase 3B
NCBI Official Symbol
KDM3B
NCBI Official Synonym Symbols
5qNCA; NET22; C5orf7; JMJD1B
NCBI Protein Information
lysine-specific demethylase 3B
UniProt Protein Name
Lysine-specific demethylase 3B
UniProt Gene Name
KDM3B
UniProt Synonym Gene Names
C5orf7; JHDM2B; JMJD1B; KIAA1082
UniProt Entry Name
KDM3B_HUMAN

Uniprot Description

JMJD1B: a ubiquitous protein demethylase that specifically demethylates Lys-9 of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity. Three alternatively spliced isoforms have been reported.

Protein type: EC 1.14.11.-; Oxidoreductase; Demethylase

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm

Molecular Function: dioxygenase activity; metal ion binding

Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; chromatin modification

Research Articles on KDM3B

Similar Products

Product Notes

The KDM3B kdm3b (Catalog #AAA3204526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JMJD1B antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's JMJD1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM3B kdm3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VHNLYSCIKV AEDFVSPEHV KHCFRLTQEF RHLSNTHTNH EDKLQVKNII. It is sometimes possible for the material contained within the vial of "JMJD1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.