Western Blot (WB)
(Western Blot detection against Immunogen (37.18kD))
Mouse anti-Human HLX1 Monoclonal Antibody | anti-HLX1 antibody
HLX1 (H2.0-like Homeobox Protein, Homeobox Protein HB24, Homeobox Protein HLX1, HLX) (FITC)
Gene Names
HLX; HB24; HLX1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HLX1; Monoclonal Antibody; HLX1 (H2.0-like Homeobox Protein; Homeobox Protein HB24; Homeobox Protein HLX1; HLX) (FITC); anti-HLX1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B9
Specificity
Recognizes human HLX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HLX1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa176-279 from human HLX1 (NP_068777) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FGIDRILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPLNSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.18kD))
Western Blot (WB)
(Western Blot detection against Immunogen (37.18kD))
Western Blot (WB)
(Western Blot analysis of HLX expression in transfected 293T cell line by HLX1 monoclonal antibody. Lane 1: HLX transfected lysate (Predicted MW: 50.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of HLX expression in transfected 293T cell line by HLX1 monoclonal antibody. Lane 1: HLX transfected lysate (Predicted MW: 50.8kD). Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of HLX transfected lysate using HLX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLX rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of HLX transfected lysate using HLX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HLX rabbit polyclonal antibody.)
Related Product Information for anti-HLX1 antibody
HLX1 homeobox protein (H2.0-like homeobox protein) is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. HLX1 is involved in embryogenesis and hematopoiesis and is located in the nucleus. HLX1 can be found at low levels in normal B and T-cells, and at high levels in activated lymphocytes and monocytes. HLX1 can also found in thymus, tonsil, bone marrow, developing vessels, and fetal brain tissue.
Product Categories/Family for anti-HLX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
H2.0-like homeobox protein
NCBI Official Synonym Full Names
H2.0 like homeobox
NCBI Official Symbol
HLX
NCBI Official Synonym Symbols
HB24; HLX1
NCBI Protein Information
H2.0-like homeobox protein
UniProt Protein Name
H2.0-like homeobox protein
UniProt Gene Name
HLX
UniProt Synonym Gene Names
HLX1
UniProt Entry Name
HLX_HUMAN
Uniprot Description
HLX: Transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis. Belongs to the H2.0 homeobox family.
Protein type: DNA-binding
Chromosomal Location of Human Ortholog: 1q41
Cellular Component: nucleus
Molecular Function: protein binding; sequence-specific DNA binding
Biological Process: negative regulation of T-helper 2 cell differentiation; skeletal muscle development; regulation of transcription, DNA-dependent; transcription, DNA-dependent; embryonic digestive tract morphogenesis; multicellular organismal development; positive regulation of cell proliferation; positive regulation of T-helper 1 cell differentiation; liver development; cell differentiation; enteric nervous system development; positive regulation of organ growth
Research Articles on HLX1
Similar Products
Product Notes
The HLX1 hlx (Catalog #AAA6147600) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HLX1 (H2.0-like Homeobox Protein, Homeobox Protein HB24, Homeobox Protein HLX1, HLX) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HLX1 hlx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HLX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
