Rabbit HLA-E Polyclonal Antibody | anti-HLA-E antibody

HLA-E Polyclonal Antibody

Cat. Num. AAA9134216

• Gene Names: HLA-E; QA1; HLA-6.2
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: HLA-E; Polyclonal Antibody; HLA-E Polyclonal Antibody; EA1.2; EA2.1; HLA-6.2; MHC; QA1; anti-HLA-E antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETL
• Sequence Length: 358

• Applicable Applications for anti-HLA-E antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human HLA-E
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Membrane, Single-pass type I membrane protein
• Positive Samples: HL-60, SKOV3, mouse liver, rat liver
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using HLA-E antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.)

Related Product Information for anti-HLA-E antibody

HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail.

Product Categories/Family for anti-HLA-E antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 62912479
• NCBI GeneID: 3133
• NCBI Accession #: NP_005507.3
• NCBI GenBank Nucleotide #: NM_005516.5
• UniProt Accession #: P13747; Q30169; Q9BT83; Q9GIY7; Q9GIY8
• Molecular Weight: Calculated: 40kDa; Observed: 50kDa
• NCBI Official Full Name: HLA class I histocompatibility antigen, alpha chain E
• NCBI Official Synonym Full Names: major histocompatibility complex, class I, E
• NCBI Official Symbol: HLA-E
• NCBI Official Synonym Symbols: QA1; HLA-6.2
• NCBI Protein Information: HLA class I histocompatibility antigen, alpha chain E
• UniProt Protein Name: HLA class I histocompatibility antigen, alpha chain E
• Protein Family: HLA class I histocompatibility antigen
• UniProt Gene Name: HLA-E
• UniProt Synonym Gene Names: HLA-6.2; HLAE

NCBI Description

HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. [provided by RefSeq, Jul 2008]

Uniprot Description

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.