Western Blot (WB)
(Anti-HKDC1 Picoband antibody, MBS177860, Western blottingAll lanes: Anti HKDC1 (MBS177860) at 0.5ug/mlLane 1: 293T Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 103KDObserved bind size: 170KD )
anti-Human HKDC1 Polyclonal Antibody | anti-HKDC1 antibody
Anti-HKDC1 Antibody
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
HKDC1; Polyclonal Antibody; Anti-HKDC1 Antibody; Putative hexokinase HKDC1; BC016235; Hexokinase domain-containing protein 1; Hkdc1; HKDC1_HUMAN; hexokinase domain containing 1; anti-HKDC1 antibody
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
917
Applicable Applications for anti-HKDC1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti-HKDC1 Picoband antibody, MBS177860, Western blottingAll lanes: Anti HKDC1 (MBS177860) at 0.5ug/mlLane 1: 293T Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 103KDObserved bind size: 170KD )
Western Blot (WB)
(Anti-HKDC1 Picoband antibody, MBS177860, Western blottingAll lanes: Anti HKDC1 (MBS177860) at 0.5ug/mlLane 1: 293T Whole Cell Lysate at 40ugLane 2: SW620 Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 103KDObserved bind size: 170KD )
Related Product Information for anti-HKDC1 antibody
Description: Rabbit IgG polyclonal antibody for Putative hexokinase HKDC1(HKDC1) detection. Tested with WB in Human.
Background: The epidermal growth factor receptor (HKDC1; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: HKDC1 (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). HKDC1 exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor alpha (TGFalpha). HKDC1 and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to HKDC1 overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of HKDC1, called HKDC1vIII is often observed.
Background: The epidermal growth factor receptor (HKDC1; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: HKDC1 (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). HKDC1 exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor alpha (TGFalpha). HKDC1 and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to HKDC1 overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of HKDC1, called HKDC1vIII is often observed.
References
1. Herbst RS (2004). "Review of epidermal growth factor receptor biology". Int. J. Radiat. Oncol. Biol. Phys. 59 (2 Suppl): 21-6. 2. Wang, K.; Yamamoto, H.; Chin, J. R.; Werb, Z.; Vu, T. H.: Epidermal growth factor receptor-deficient mice have delayed primary endochondral ossification because of defective osteoclast recruitment. J. Biol. Chem. 279: 53848-53856, 2004. 3. Kuan CT, Wikstrand CJ, Bigner DD (June 2001). "EGF mutant receptor vIII as a molecular target in cancer therapy". Endocr. Relat. Cancer 8 (2): 83-96.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,682 Da
NCBI Official Full Name
putative hexokinase HKDC1
NCBI Official Synonym Full Names
hexokinase domain containing 1
NCBI Official Symbol
HKDC1
NCBI Protein Information
putative hexokinase HKDC1
UniProt Protein Name
Putative hexokinase HKDC1
Protein Family
UniProt Gene Name
HKDC1
UniProt Entry Name
HKDC1_HUMAN
Uniprot Description
HKDC1: Belongs to the hexokinase family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 2.7.1.1; Kinase, other
Chromosomal Location of Human Ortholog: 10q22.1
Cellular Component: cytosol
Molecular Function: ATP binding; fructokinase activity; glucokinase activity; glucose binding; mannokinase activity
Biological Process: carbohydrate phosphorylation; cell glucose homeostasis; glucose 6-phosphate metabolic process; glycolysis; hexose metabolic process
Research Articles on HKDC1
Similar Products
Product Notes
The HKDC1 hkdc1 (Catalog #AAA177860) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-HKDC1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HKDC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the HKDC1 hkdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HKDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
