Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HK2Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HK2 Polyclonal Antibody | anti-HK2 antibody

HK2 Antibody - middle region

Gene Names
HK2; HKII; HXK2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HK2; Polyclonal Antibody; HK2 Antibody - middle region; anti-HK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYM
Sequence Length
917
Applicable Applications for anti-HK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HK2Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HK2Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HK2 antibody
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
Product Categories/Family for anti-HK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100 kDa
NCBI Official Full Name
hexokinase-2
NCBI Official Synonym Full Names
hexokinase 2
NCBI Official Symbol
HK2
NCBI Official Synonym Symbols
HKII; HXK2
NCBI Protein Information
hexokinase-2
UniProt Protein Name
Hexokinase-2
Protein Family
UniProt Gene Name
HK2
UniProt Synonym Gene Names
HK II
UniProt Entry Name
HXK2_HUMAN

NCBI Description

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]

Uniprot Description

HK2: a glycolytic enzyme that catalyzes the reaction ATP + D-hexose = ADP + D-hexose 6-phosphate. The first and rate-limiting step in glycosis, a pathway that produces energy in the form of ATP from glucose. An allosteric enzyme inhibited by its product glucose-6-phosphate (Glc-6-P). The predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle. Acts as a ""glucose sensor"" by trapping glucose inside the cell by catalyzing its phosphorylation to produce Glc-6-P. In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase). Genetic variations of HK2 do not appear to contribute to NIDDM.

Protein type: Kinase, other; Carbohydrate Metabolism - starch and sucrose; EC 2.7.1.1; Carbohydrate Metabolism - fructose and mannose; Carbohydrate Metabolism - galactose; Mitochondrial; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Carbohydrate Metabolism - glycolysis and gluconeogenesis

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: mitochondrial outer membrane; membrane; cytosol

Molecular Function: hexokinase activity; mannokinase activity; fructokinase activity; glucokinase activity; ATP binding; glucose binding

Biological Process: lactation; apoptotic mitochondrial changes; glycolysis; hexose transport; glucose 6-phosphate metabolic process; carbohydrate metabolic process; carbohydrate phosphorylation; glucose metabolic process; cell glucose homeostasis; regulation of glucose import; pathogenesis; glucose transport; transmembrane transport

Research Articles on HK2

Similar Products

Product Notes

The HK2 hk2 (Catalog #AAA3223065) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HK2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HK2 hk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRMCINMEWG AFGDDGSLND IRTEFDQEID MGSLNPGKQL FEKMISGMYM. It is sometimes possible for the material contained within the vial of "HK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.