Western Blot (WB)
(Host: RabbitTarget Name: HIST3H2BBSample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse HIST3H2BB Polyclonal Antibody | anti-HIST3H2BB antibody
HIST3H2BB Antibody - middle region
Gene Names
Hist3h2bb-ps; R75370; Hist3h2bb; 4933432H21; B2Hist3h2bb; 4930534G10Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
HIST3H2BB; Polyclonal Antibody; HIST3H2BB Antibody - middle region; anti-HIST3H2BB antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVN
Sequence Length
126
Applicable Applications for anti-HIST3H2BB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HIST3H2BB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HIST3H2BBSample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HIST3H2BBSample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-HIST3H2BB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14 kDa
NCBI Official Synonym Full Names
histone cluster 3, H2bb, pseudogene
NCBI Official Symbol
Hist3h2bb-ps
NCBI Official Synonym Symbols
R75370; Hist3h2bb; 4933432H21; B2Hist3h2bb; 4930534G10Rik
UniProt Protein Name
Histone H2B type 3-B
Protein Family
UniProt Gene Name
Hist3h2bb
UniProt Synonym Gene Names
Hist3h2bb-ps
UniProt Entry Name
H2B3B_MOUSE
NCBI Description
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is a histone pseudogene found on chromosome 11. [provided by RefSeq, Oct 2015]
Similar Products
Product Notes
The HIST3H2BB hist3h2bb (Catalog #AAA3223887) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIST3H2BB Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HIST3H2BB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIST3H2BB hist3h2bb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTKAQKKDGK KRKRGRKESY SIYVYKVLKQ VHPDTGISSK AMGIMNSFVN. It is sometimes possible for the material contained within the vial of "HIST3H2BB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
