Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HDAC5Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HDAC5 Polyclonal Antibody | anti-HDAC5 antibody

HDAC5 Antibody - middle region

Gene Names
HDAC5; HD5; NY-CO-9
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HDAC5; Polyclonal Antibody; HDAC5 Antibody - middle region; anti-HDAC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKLPLPGPYDSRDDFPLR
Sequence Length
1037
Applicable Applications for anti-HDAC5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human HDAC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HDAC5Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HDAC5Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HDAC5 antibody
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HDAC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114 kDa
NCBI Official Full Name
histone deacetylase 5 isoform 3
NCBI Official Synonym Full Names
histone deacetylase 5
NCBI Official Symbol
HDAC5
NCBI Official Synonym Symbols
HD5; NY-CO-9
NCBI Protein Information
histone deacetylase 5
UniProt Protein Name
Histone deacetylase 5
UniProt Gene Name
HDAC5
UniProt Synonym Gene Names
KIAA0600; HD5
UniProt Entry Name
HDAC5_HUMAN

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HDAC5: a transcriptional regulator of the histone deacetylase family, subfamily 2. Deacetylates lysine residues on the N-terminal part of the core histones H2A, H2B, H3 AND H4. Plays an important role in transcriptional regulation, cell cycle progression and developmental events. Coimmunoprecipitates only with HDAC3 family members. Interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. Two alternatively spliced isoforms have been described.

Protein type: EC 3.5.1.98; Hydrolase

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleoplasm; nuclear body; Golgi apparatus; histone deacetylase complex; cytoplasm; nucleus; cytosol

Molecular Function: NAD-dependent histone deacetylase activity (H3-K9 specific); protein binding; protein kinase C binding; NAD-dependent histone deacetylase activity (H3-K14 specific); histone deacetylase binding; metal ion binding; protein deacetylase activity; NAD-dependent histone deacetylase activity (H4-K16 specific); histone deacetylase activity; transcription corepressor activity; transcription factor binding

Biological Process: establishment and/or maintenance of chromatin architecture; heart development; chromatin silencing; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic; protein amino acid deacetylation; negative regulation of osteoblast differentiation; inflammatory response; response to drug; Notch signaling pathway; regulation of skeletal muscle fiber development; transcription, DNA-dependent; B cell activation; histone deacetylation; chromatin modification; response to cocaine; osteoblast development; chromatin remodeling; cellular response to insulin stimulus; regulation of protein binding; B cell differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; negative regulation of transcription, DNA-dependent; multicellular organismal response to stress

Research Articles on HDAC5

Similar Products

Product Notes

The HDAC5 hdac5 (Catalog #AAA3223219) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HDAC5 hdac5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLPQHPKCWG AHHASLDQSS PPQSGPPGTP PSYKLPLPGP YDSRDDFPLR. It is sometimes possible for the material contained within the vial of "HDAC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.