Western Blot (WB)
(Host: RabbitTarget Name: RBMXSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse RBMX Polyclonal Antibody | anti-RBMX antibody
RBMX Antibody-middle region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RBMX; Polyclonal Antibody; RBMX Antibody-middle region; RNA binding motif protein; X-linked-like-1; Rbmx; Hnrpg; Rbmxrt; anti-RBMX antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
DAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGS
Applicable Applications for anti-RBMX antibody
Western Blot (WB)
Protein Size
388 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse RBMX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RBMXSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RBMXSample Tissue: Mouse Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RBMX antibody
Description of Target: RNA-binding protein which may be involved in pre-mRNA splicing.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
42kDa
UniProt Protein Name
RNA binding motif protein, X-linked-like-1
Protein Family
UniProt Gene Name
Rbmxl1
UniProt Synonym Gene Names
Rbmxrt
UniProt Entry Name
RMXL1_MOUSE
Uniprot Description
RBMXRT: RNA-binding protein which may be involved in pre-mRNA splicing.
Protein type: RNA processing; RNA-binding
Cellular Component: nucleus; ribonucleoprotein complex
Molecular Function: protein binding; nucleic acid binding; RNA binding; nucleotide binding; chromatin binding
Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; mRNA splice site selection; negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; positive regulation of transcription from RNA polymerase II promoter; mRNA processing; protein homooligomerization; regulation of alternative nuclear mRNA splicing, via spliceosome
Similar Products
Product Notes
The RBMX rbmxl1 (Catalog #AAA3249849) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBMX Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RBMX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBMX rbmxl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DAARDMNGKS LDGKAIKVEQ ATKPSFESGR RGPPPPPRSR GPPRGLRGGS. It is sometimes possible for the material contained within the vial of "RBMX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
