Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HIBADH rabbit polyclonal antibody. Western Blot analysis of HIBADH expression in mouse kidney.)

Rabbit anti-Human, Mouse HIBADH Polyclonal Antibody | anti-HIBADH antibody

HIBADH (3-hydroxyisobutyrate Dehydrogenase, Mitochondrial, HIBADH, MGC40361, NS5ATP1) (AP)

Gene Names
HIBADH; NS5ATP1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIBADH; Polyclonal Antibody; HIBADH (3-hydroxyisobutyrate Dehydrogenase; Mitochondrial; MGC40361; NS5ATP1) (AP); anti-HIBADH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HIBADH. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HIBADH antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HIBADH, aa1-336 (NP_689953.1).
Immunogen Sequence
MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(HIBADH rabbit polyclonal antibody. Western Blot analysis of HIBADH expression in mouse kidney.)

Western Blot (WB) (HIBADH rabbit polyclonal antibody. Western Blot analysis of HIBADH expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of HIBADH expression in transfected 293T cell line by HIBADH polyclonal antibody. Lane 1: HIBADH transfected lysate (35.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HIBADH expression in transfected 293T cell line by HIBADH polyclonal antibody. Lane 1: HIBADH transfected lysate (35.3kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-HIBADH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,329 Da
NCBI Official Full Name
3-hydroxyisobutyrate dehydrogenase, mitochondrial
NCBI Official Synonym Full Names
3-hydroxyisobutyrate dehydrogenase
NCBI Official Symbol
HIBADH
NCBI Official Synonym Symbols
NS5ATP1
NCBI Protein Information
3-hydroxyisobutyrate dehydrogenase, mitochondrial; 3'-hydroxyisobutyrate dehydrogenase
UniProt Protein Name
3-hydroxyisobutyrate dehydrogenase, mitochondrial
UniProt Gene Name
HIBADH
UniProt Synonym Gene Names
HIBADH
UniProt Entry Name
3HIDH_HUMAN

NCBI Description

This gene encodes a mitochondrial 3-hydroxyisobutyrate dehydrogenase enzyme. The encoded protein plays a critical role in the catabolism of L-valine by catalyzing the oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde. [provided by RefSeq, Nov 2011]

Uniprot Description

HIBADH: a mitochondrial 3-hydroxyisobutyrate dehydrogenase enzyme. The encoded protein plays a critical role in the catabolism of L-valine by catalyzing the oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde. [provided by RefSeq, Nov 2011]

Protein type: EC 1.1.1.31; Mitochondrial; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Oxidoreductase

Chromosomal Location of Human Ortholog: 7p15.2

Cellular Component: mitochondrial matrix

Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity; 3-hydroxyisobutyrate dehydrogenase activity; NAD binding

Biological Process: pentose-phosphate shunt; valine catabolic process; branched chain family amino acid catabolic process

Research Articles on HIBADH

Similar Products

Product Notes

The HIBADH hibadh (Catalog #AAA6381100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIBADH (3-hydroxyisobutyrate Dehydrogenase, Mitochondrial, HIBADH, MGC40361, NS5ATP1) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HIBADH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIBADH hibadh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIBADH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.