Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Hexokinase 2 antibody (MBS5300525) used at 1 ug/ml to detect target protein.)

Rabbit Hexokinase 2 Polyclonal Antibody | anti-HK2 antibody

Hexokinase 2 antibody

Gene Names
HK2; HKII; HXK2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Hexokinase 2; Polyclonal Antibody; Hexokinase 2 antibody; Polyclonal Hexokinase 2; Anti-Hexokinase 2; HKII; DKFZp686M1669; Hexokinase Type -2; HXK2; Hexokinase Type 2; HK2; anti-HK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Hexokinase 2 antibody was raised against the middle region of HK2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HK2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
917
Applicable Applications for anti-HK2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
Cross-Reactivity
Human
Immunogen
Hexokinase 2 antibody was raised using the middle region of HK2 corresponding to a region with amino acids QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Hexokinase 2 antibody (MBS5300525) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Hexokinase 2 antibody (MBS5300525) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-HK2 antibody
Rabbit polyclonal Hexokinase 2 antibody raised against the middle region of HK2
Product Categories/Family for anti-HK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
102 kDa (MW of target protein)
NCBI Official Full Name
Hexokinase 2
NCBI Official Synonym Full Names
hexokinase 2
NCBI Official Symbol
HK2
NCBI Official Synonym Symbols
HKII; HXK2
NCBI Protein Information
hexokinase-2
UniProt Protein Name
Hexokinase-2
Protein Family
UniProt Gene Name
HK2
UniProt Synonym Gene Names
HK II
UniProt Entry Name
HXK2_HUMAN

NCBI Description

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009]

Uniprot Description

HK2: a glycolytic enzyme that catalyzes the reaction ATP + D-hexose = ADP + D-hexose 6-phosphate. The first and rate-limiting step in glycosis, a pathway that produces energy in the form of ATP from glucose. An allosteric enzyme inhibited by its product glucose-6-phosphate (Glc-6-P). The predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle. Acts as a ""glucose sensor"" by trapping glucose inside the cell by catalyzing its phosphorylation to produce Glc-6-P. In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III and IV (glucokinase). Genetic variations of HK2 do not appear to contribute to NIDDM.

Protein type: Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - amino sugar and nucleotide sugar; EC 2.7.1.1; Kinase, other; Mitochondrial; Carbohydrate Metabolism - starch and sucrose; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: mitochondrial outer membrane; membrane; cytosol

Molecular Function: hexokinase activity; mannokinase activity; fructokinase activity; glucokinase activity; ATP binding; glucose binding

Biological Process: lactation; apoptotic mitochondrial changes; glycolysis; hexose transport; glucose 6-phosphate metabolic process; carbohydrate phosphorylation; carbohydrate metabolic process; glucose metabolic process; cell glucose homeostasis; pathogenesis; regulation of glucose import; glucose transport; transmembrane transport

Research Articles on HK2

Similar Products

Product Notes

The HK2 hk2 (Catalog #AAA5300525) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Hexokinase 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the HK2 hk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hexokinase 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.