Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HES1 rabbit polyclonal antibody. Western Blot analysis of HES1 expression in human kidney.)

Rabbit anti-Human, Mouse HES1 Polyclonal Antibody | anti-HES1 antibody

HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (Biotin)

Gene Names
HES1; HHL; HRY; HES-1; bHLHb39
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HES1; Polyclonal Antibody; HES1 (Hairy and Enhancer of Split 1; HES-1; bHLHb39; Class B Basic Helix-loop-helix Protein 39; FLJ20408; Hairy Homolog; Hairy-like Protein; hHL; HL; HRY; Transcription Factor HES-1) (Biotin); anti-HES1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HES1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1460
Applicable Applications for anti-HES1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HES1, aa1-277 (AAH39152.1).
Immunogen Sequence
MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HES1 rabbit polyclonal antibody. Western Blot analysis of HES1 expression in human kidney.)

Western Blot (WB) (HES1 rabbit polyclonal antibody. Western Blot analysis of HES1 expression in human kidney.)

Western Blot (WB)

(HES1 rabbit polyclonal antibody. Western Blot analysis of HES1 expression in mouse spleen.)

Western Blot (WB) (HES1 rabbit polyclonal antibody. Western Blot analysis of HES1 expression in mouse spleen.)

Western Blot (WB)

(Western Blot analysis of HES1 expression in transfected 293T cell line by HES1 polyclonal antibody. Lane 1: HES1 transfected lysate (29.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HES1 expression in transfected 293T cell line by HES1 polyclonal antibody. Lane 1: HES1 transfected lysate (29.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HES1 antibody
HES1 is a transcriptional repressor of genes that require a bHLH protein for their transcription. It may act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. HES1 is expressed in developing neuroectodermal and endodermal endocrine tissues, and HES1 deficient embryos show severe defects in neuronal development, as well as pancreatic hypoplasia.
Product Categories/Family for anti-HES1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Homo sapiens hairy and enhancer of split 1, (Drosophila), mRNA
NCBI Official Synonym Full Names
hes family bHLH transcription factor 1
NCBI Official Symbol
HES1
NCBI Official Synonym Symbols
HHL; HRY; HES-1; bHLHb39
NCBI Protein Information
transcription factor HES-1
UniProt Protein Name
Transcription factor HES-1
Protein Family
UniProt Gene Name
HES1
UniProt Synonym Gene Names
BHLHB39; HL; HRY; bHLHb39; hHL
UniProt Entry Name
HES1_HUMAN

NCBI Description

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq, Jul 2008]

Research Articles on HES1

Similar Products

Product Notes

The HES1 hes1 (Catalog #AAA6380992) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HES1 (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HES1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HES1 hes1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HES1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.