Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HERC6 antibody - N-terminal region validated by WB using hek293 cell lysate at 1:1000.HERC6 is supported by BioGPS gene expression data to be expressed in HEK293)

Rabbit HERC6 Polyclonal Antibody | anti-HERC6 antibody

HERC6 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HERC6; Polyclonal Antibody; HERC6 antibody - N-terminal region; anti-HERC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH
Sequence Length
1022
Applicable Applications for anti-HERC6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HERC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(HERC6 antibody - N-terminal region validated by WB using hek293 cell lysate at 1:1000.HERC6 is supported by BioGPS gene expression data to be expressed in HEK293)

Western Blot (WB) (HERC6 antibody - N-terminal region validated by WB using hek293 cell lysate at 1:1000.HERC6 is supported by BioGPS gene expression data to be expressed in HEK293)

Western Blot (WB)

(WB Suggested Anti-HERC6 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-HERC6 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)
Related Product Information for anti-HERC6 antibody
This is a rabbit polyclonal antibody against HERC6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).
Product Categories/Family for anti-HERC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
probable E3 ubiquitin-protein ligase HERC6 isoform 1
NCBI Official Synonym Full Names
HECT and RLD domain containing E3 ubiquitin protein ligase family member 6
NCBI Official Symbol
HERC6
NCBI Protein Information
probable E3 ubiquitin-protein ligase HERC6
UniProt Protein Name
Probable E3 ubiquitin-protein ligase HERC6
Protein Family
UniProt Gene Name
HERC6

NCBI Description

HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM, Mar 2008]

Uniprot Description

HERC6: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 4q22.1

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: ubiquitin-protein transferase activity

Biological Process: hemopoietic progenitor cell differentiation; protein polyubiquitination

Research Articles on HERC6

Similar Products

Product Notes

The HERC6 herc6 (Catalog #AAA3206777) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HERC6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HERC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HERC6 herc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSKDSQVFSW GKNSHGQLGL GKEFPSQASP QRVRSLEGIP LAQVAAGGAH. It is sometimes possible for the material contained within the vial of "HERC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.