Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ENSA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Rabbit ENSA Polyclonal Antibody | anti-ENSA antibody

ENSA antibody - N-terminal region

Gene Names
ENSA; ARPP-19e
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENSA; Polyclonal Antibody; ENSA antibody - N-terminal region; anti-ENSA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL
Sequence Length
113
Applicable Applications for anti-ENSA antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ENSA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ENSA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-ENSA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
Related Product Information for anti-ENSA antibody
This is a rabbit polyclonal antibody against ENSA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12
NCBI Official Full Name
alpha-endosulfine isoform 7
NCBI Official Synonym Full Names
endosulfine alpha
NCBI Official Symbol
ENSA
NCBI Official Synonym Symbols
ARPP-19e
NCBI Protein Information
alpha-endosulfine
UniProt Protein Name
Alpha-endosulfine
Protein Family
UniProt Gene Name
ENSA
UniProt Entry Name
ENSA_HUMAN

NCBI Description

The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

ENSA: a cytoplasmic, highly conserved cAMP-regulated phosphoprotein (ARPP) and regulator of ATP-sensitive potassium (KATP) channels. An endogenous ligand for the sulfonylurea receptor, ABCC8, the regulatory subunit of the KATP channel located on the plasma membrane of pancreatic beta cells. Modulates insulin secretion through the interaction with ABCC8, and may be associated with type 2 diabetes. Eight alternatively spliced isoforms have been observed.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: phosphatase inhibitor activity; protein phosphatase 2A binding; protein phosphatase type 2A regulator activity; protein phosphatase inhibitor activity; potassium channel inhibitor activity; ion channel inhibitor activity; receptor binding

Biological Process: mitosis; regulation of catalytic activity; transport; cell division; negative regulation of catalytic activity; response to glucose stimulus; mitotic cell cycle; G2/M transition of mitotic cell cycle; regulation of insulin secretion; response to nutrient

Research Articles on ENSA

Similar Products

Product Notes

The ENSA ensa (Catalog #AAA3211346) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENSA antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENSA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENSA ensa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAGGLGCDVC YWFVEDTQEK EGILPERAEE AKLKAKYPSL GQKPGGSDFL. It is sometimes possible for the material contained within the vial of "ENSA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.