Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HCFC2 antibody Titration: 1 ug/mLSample Type: Human 721_B Whole Cell)

Rabbit HCFC2 Polyclonal Antibody | anti-HCFC2 antibody

HCFC2 Antibody - C-terminal region

Gene Names
HCFC2; HCF2; HCF-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
HCFC2; Polyclonal Antibody; HCFC2 Antibody - C-terminal region; anti-HCFC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRW
Sequence Length
792
Applicable Applications for anti-HCFC2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HCFC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HCFC2 antibody Titration: 1 ug/mLSample Type: Human 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-HCFC2 antibody Titration: 1 ug/mLSample Type: Human 721_B Whole Cell)
Related Product Information for anti-HCFC2 antibody
This is a rabbit polyclonal antibody against HCFC2. It was validated on Western Blot

Target Description: This gene encodes one of two proteins which interact with VP16, a herpes simplex virus protein that initiates virus infection. Both the encoded protein and the original Herpes host cell factor interact with VP16 through a beta-propeller domain. The original Herpes host cell factor, however, is effective at initiating viral infection while the encoded protein is not. Transcripts of varying length due to alternative polyadenylation signals have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87 kDa
NCBI Official Full Name
host cell factor 2
NCBI Official Synonym Full Names
host cell factor C2
NCBI Official Symbol
HCFC2
NCBI Official Synonym Symbols
HCF2; HCF-2
NCBI Protein Information
host cell factor 2
UniProt Protein Name
Host cell factor 2
Protein Family
UniProt Gene Name
HCFC2
UniProt Synonym Gene Names
HCF-2
UniProt Entry Name
HCFC2_HUMAN

NCBI Description

This gene encodes one of two proteins which interact with VP16, a herpes simplex virus protein that initiates virus infection. Both the encoded protein and the original Herpes host cell factor interact with VP16 through a beta-propeller domain. The original Herpes host cell factor, however, is effective at initiating viral infection while the encoded protein is not. Transcripts of varying length due to alternative polyadenylation signals have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

HCFC2: Binds MLL. Component of the MLL1/MLL complex, at least composed of MLL, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1 and HCFC2.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 12q23.3

Cellular Component: nucleoplasm; cytoplasm; plasma membrane; nucleus

Molecular Function: transcription coactivator activity

Biological Process: regulation of transcription from RNA polymerase II promoter; viral reproduction; negative regulation of transcription from RNA polymerase II promoter

Similar Products

Product Notes

The HCFC2 hcfc2 (Catalog #AAA3200644) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCFC2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HCFC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HCFC2 hcfc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIYCGLKTSC IVTAGQLANA HIDYTSRPAI VFRISAKNEK GYGPATQVRW. It is sometimes possible for the material contained within the vial of "HCFC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.