Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HCFC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Rabbit HCFC1 Polyclonal Antibody | anti-HCFC1 antibody

HCFC1 antibody - middle region

Gene Names
HCFC1; CFF; HCF; HCF1; HFC1; MRX3; VCAF; HCF-1; PPP1R89
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HCFC1; Polyclonal Antibody; HCFC1 antibody - middle region; anti-HCFC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADG
Sequence Length
2035
Applicable Applications for anti-HCFC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HCFC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HCFC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HCFC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Hum. Fetal Heart)

Western Blot (WB) (Hum. Fetal Heart)

Western Blot (WB)

(Hum. Fetal Liver)

Western Blot (WB) (Hum. Fetal Liver)

Western Blot (WB)

(Lanes:Lane1: HIS-HCFC1 16-363aa (42kD) transformed bacteria lysateLane2: GFP-HCFC1 363-2002aa (73kD) transformed bacteria lysate elution samplePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit AlexaFluor 680Secondary Antibody Dilution:1:10000Gene Name:HCFC1Submitted by:Anonymous)

Western Blot (WB) (Lanes:Lane1: HIS-HCFC1 16-363aa (42kD) transformed bacteria lysateLane2: GFP-HCFC1 363-2002aa (73kD) transformed bacteria lysate elution samplePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit AlexaFluor 680Secondary Antibody Dilution:1:10000Gene Name:HCFC1Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-HCFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-HCFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)
Related Product Information for anti-HCFC1 antibody
This is a rabbit polyclonal antibody against HCFC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HCFC1 is a member of the host cell factor family with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possib

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
209kDa
NCBI Official Full Name
host cell factor 1
NCBI Official Synonym Full Names
host cell factor C1
NCBI Official Symbol
HCFC1
NCBI Official Synonym Symbols
CFF; HCF; HCF1; HFC1; MRX3; VCAF; HCF-1; PPP1R89
NCBI Protein Information
host cell factor 1
UniProt Protein Name
Host cell factor 1
Protein Family
UniProt Gene Name
HCFC1
UniProt Synonym Gene Names
HCF1; HFC1; HCF; HCF-1
UniProt Entry Name
HCFC1_HUMAN

NCBI Description

This gene is a member of the host cell factor family and encodes a protein with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

HCFC1: Involved in control of the cell cycle. Also antagonizes transactivation by ZBTB17 and GABP2; represses ZBTB17 activation of the p15(INK4b) promoter and inhibits its ability to recruit p300. Coactivator for EGR2 and GABP2. Tethers the chromatin modifying Set1/Ash2 histone H3 'Lys-4' methyltransferase (H3K4me) and Sin3 histone deacetylase (HDAC) complexes (involved in the activation and repression of transcription, respectively) together. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. In case of human herpes simplex virus (HSV) infection, HCFC1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and POU2F1 thereby enabling the transcription of the viral immediate early genes. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: nucleoplasm; cell soma; mitochondrion; membrane; cytoplasm; nucleus; histone acetyltransferase complex

Molecular Function: identical protein binding; protein binding; transcription coactivator activity; chromatin binding; histone acetyltransferase activity (H4-K16 specific); transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; mitochondrion organization and biogenesis; establishment and/or maintenance of chromatin architecture; protein stabilization; regulation of transcription, DNA-dependent; organelle organization and biogenesis; reactivation of latent virus; regulation of protein complex assembly; positive regulation of cell cycle; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; cell cycle

Disease: Methylmalonic Acidemia And Homocysteinemia, Cblx Type

Research Articles on HCFC1

Similar Products

Product Notes

The HCFC1 hcfc1 (Catalog #AAA3204175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCFC1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HCFC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HCFC1 hcfc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARNEKGYGPA TQVRWLQETS KDSSGTKPAN KRPMSSPEMK SAPKKSKADG. It is sometimes possible for the material contained within the vial of "HCFC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.