Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HAUS8 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit anti-Human, Pig HAUS8 Polyclonal Antibody | anti-HAUS8 antibody

HAUS8 antibody - N-terminal region

Gene Names
HAUS8; DGT4; HICE1; NY-SAR-48
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HAUS8; Polyclonal Antibody; HAUS8 antibody - N-terminal region; anti-HAUS8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTRGKMSEGGRKSSLLQKSKADSSGVGKGDLQSTLLEGHGTAPPDLDLSA
Sequence Length
410
Applicable Applications for anti-HAUS8 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HAUS8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HAUS8 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-HAUS8 Antibody Titration: 0.125ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-HAUS8 antibody
This is a rabbit polyclonal antibody against HAUS8. It was validated on Western Blot

Target Description: HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).
Product Categories/Family for anti-HAUS8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
HAUS augmin-like complex subunit 8 isoform a
NCBI Official Synonym Full Names
HAUS augmin like complex subunit 8
NCBI Official Symbol
HAUS8
NCBI Official Synonym Symbols
DGT4; HICE1; NY-SAR-48
NCBI Protein Information
HAUS augmin-like complex subunit 8
UniProt Protein Name
HAUS augmin-like complex subunit 8
Protein Family
UniProt Gene Name
HAUS8
UniProt Synonym Gene Names
HICE1
UniProt Entry Name
HAUS8_HUMAN

NCBI Description

HAUS8 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).[supplied by OMIM, Jun 2010]

Uniprot Description

HAUS8: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Belongs to the HAUS8 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: spindle pole; microtubule; centrosome; cytoplasm

Biological Process: mitosis; centrosome organization and biogenesis; cell division; spindle assembly

Research Articles on HAUS8

Similar Products

Product Notes

The HAUS8 haus8 (Catalog #AAA3214558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAUS8 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's HAUS8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAUS8 haus8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTRGKMSEGG RKSSLLQKSK ADSSGVGKGD LQSTLLEGHG TAPPDLDLSA. It is sometimes possible for the material contained within the vial of "HAUS8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.