Western Blot (WB)
(WB Suggested Anti-HAUS3 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Rabbit HAUS3 Polyclonal Antibody | anti-HAUS3 antibody
HAUS3 Antibody - N-terminal region
Gene Names
HAUS3; IT1; dgt3; C4orf15
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HAUS3; Polyclonal Antibody; HAUS3 Antibody - N-terminal region; anti-HAUS3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQ
Sequence Length
603
Applicable Applications for anti-HAUS3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HAUS3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HAUS3 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-HAUS3 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-HAUS3 antibody
This is a rabbit polyclonal antibody against HAUS3. It was validated on Western Blot
Target Description: HAUS3 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly.
Target Description: HAUS3 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly.
Product Categories/Family for anti-HAUS3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
HAUS augmin-like complex subunit 3
NCBI Official Synonym Full Names
HAUS augmin like complex subunit 3
NCBI Official Symbol
HAUS3
NCBI Official Synonym Symbols
IT1; dgt3; C4orf15
NCBI Protein Information
HAUS augmin-like complex subunit 3
UniProt Protein Name
HAUS augmin-like complex subunit 3
Protein Family
UniProt Gene Name
HAUS3
UniProt Synonym Gene Names
C4orf15
UniProt Entry Name
HAUS3_HUMAN
NCBI Description
This gene encodes a component of the HAUS augmin-like protein complex, which plays a key role in cytokinesis and mitosis. Disruption of the encoded protein causes mitotic defects resulting from fragmentation of centrosomes and microtubule destabilization. This gene shares its 5' exons with some transcripts from overlapping GeneID: 353497, which encodes a DNA polymerase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Similar Products
Product Notes
The HAUS3 haus3 (Catalog #AAA3217250) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAUS3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HAUS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAUS3 haus3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NAKEEEATKK LKQSQGILNA MITKISNELQ ALTDEVTQLM MFFRHSNLGQ. It is sometimes possible for the material contained within the vial of "HAUS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
