Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Haptoglobin antibody, MBS177476, Western blottingAll lanes: Anti Haptoglobin (MBS177476) at 0.5ug/mlWB: Recombinant Human Haptoglobin Protein 0.5ngPredicted bind size: 38KDObserved bind size: 38KD )

Rabbit Haptoglobin Polyclonal Antibody | anti-HP antibody

Anti-Haptoglobin Antibody

Gene Names
HP; BP; HPA1S; HP2ALPHA2
Reactivity
Human, Mouse.
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
Haptoglobin; Polyclonal Antibody; Anti-Haptoglobin Antibody; Binding peptide antibody; Bp antibody; Haptoglobin alpha chain antibody; Haptoglobin alpha(1S) beta antibody; Haptoglobin alpha(2FS) beta antibody; Haptoglobin beta chain antibody; alpha polypeptide antibody; beta polypeptide antibody; HP antibody; Hp2 alpha antibody; HP2 ALPHA2 antibody; HP2ALPHA2 antibody; HPA1S antibody; HPT antibody; HPT_HUMAN antibody; MGC111141 antibody; Zonulin antibody; haptoglobin; anti-HP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse.
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3
Sequence Length
347
Applicable Applications for anti-HP antibody
Western Blot (WB), Immunohistochemistry - Paraffin-embedded Section (IHC-P)
Application Notes
Western Blot:
Concentration: 0.1-0.5ug/ml
Tested Species: Human, Mouse
Antigen Retrieval: -

Immunohistochemistry (Paraffin-embedded Section):
Concentration: 0.5-1ug/ml
Tested Species: Human
Antigen Retrieval: By Heat

WB: The detection limit for haptoglobin is approximately 0.2ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20mins is required for the staining of formalin/paraffin sections.

Other applications have not been tested.
Optimal dilutions should be determined by end users.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Haptoglobin antibody, MBS177476, Western blottingAll lanes: Anti Haptoglobin (MBS177476) at 0.5ug/mlWB: Recombinant Human Haptoglobin Protein 0.5ngPredicted bind size: 38KDObserved bind size: 38KD )

Western Blot (WB) (Anti- Haptoglobin antibody, MBS177476, Western blottingAll lanes: Anti Haptoglobin (MBS177476) at 0.5ug/mlWB: Recombinant Human Haptoglobin Protein 0.5ngPredicted bind size: 38KDObserved bind size: 38KD )

Western Blot (WB)

(Anti- Haptoglobin antibody, MBS177476, Western blottingAll lanes: Anti Haptoglobin (MBS177476) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SMMC Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD )

Western Blot (WB) (Anti- Haptoglobin antibody, MBS177476, Western blottingAll lanes: Anti Haptoglobin (MBS177476) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SMMC Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD )
Related Product Information for anti-HP antibody
Haptoglobin(HP), is a protein that in humans is encoded by the HP gene. Haptoglobin, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha and 2 beta polypeptides that are covalently associated by disulfide bonds. Haptoglobin is homologous to serine proteases of the chymotrypsinogen family. A major function of haptoglobin is to bind hemoglobin(Hb) to form a stable Hp-Hb complex and thereby prevent Hb-induced oxidative tissue damage. Haptoglobin is an unusual secretory protein in that it is proteolytically processed in the endoplasmic reticulum and not in the Golgi. In clinical settings, the haptoglobulin assay is used to screen for and monitor intravascular hemolytic anemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
haptoglobin isoform 2 preproprotein
NCBI Official Synonym Full Names
haptoglobin
NCBI Official Symbol
HP
NCBI Official Synonym Symbols
BP; HPA1S; HP2ALPHA2
NCBI Protein Information
haptoglobin; zonulin; binding peptide; haptoglobin alpha(1S)-beta; haptoglobin alpha(2FS)-beta; haptoglobin, beta polypeptide; haptoglobin, alpha polypeptide
UniProt Protein Name
Haptoglobin
Protein Family
UniProt Gene Name
HP
UniProt Entry Name
HPT_HUMAN

NCBI Description

This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

HP: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes. Defects in HP are the cause of anhaptoglobinemia (AHP). AHP is a condition characterized by the absence of the serum glycoprotein haptoglobin. Serum levels of haptoglobin vary among normal persons: levels are low in the neonatal period and in the elderly, differ by population, and can be influenced by environmental factors, such as infection. Secondary hypohaptoglobinemia can occur as a consequence of hemolysis, during which haptoglobin binds to free hemoglobin. Belongs to the peptidase S1 family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 16q22.2

Cellular Component: extracellular space; extracellular region

Molecular Function: antioxidant activity; protein binding; hemoglobin binding; catalytic activity

Biological Process: receptor-mediated endocytosis; response to hydrogen peroxide; immune system process; metabolic process; defense response to bacterium; negative regulation of oxidoreductase activity; acute-phase response; defense response

Disease: Anhaptoglobinemia

Research Articles on HP

Similar Products

Product Notes

The HP hp (Catalog #AAA177476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Haptoglobin Antibody reacts with Human, Mouse. and may cross-react with other species as described in the data sheet. AAA Biotech's Haptoglobin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry - Paraffin-embedded Section (IHC-P). Western Blot: Concentration: 0.1-0.5ug/ml Tested Species: Human, Mouse Antigen Retrieval: - Immunohistochemistry (Paraffin-embedded Section): Concentration: 0.5-1ug/ml Tested Species: Human Antigen Retrieval: By Heat WB: The detection limit for haptoglobin is approximately 0.2ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the HP hp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Haptoglobin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.