Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HAP1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HAP1 Polyclonal Antibody | anti-HAP1 antibody

HAP1 Antibody - middle region

Gene Names
HAP1; HLP; HAP2; HIP5; hHLP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HAP1; Polyclonal Antibody; HAP1 Antibody - middle region; anti-HAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYS
Sequence Length
671
Applicable Applications for anti-HAP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HAP1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HAP1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HAP1 antibody
Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein that interacts with huntingtin, with two cytoskeletal proteins (dynactin and pericentriolar autoantigen protein 1), and with a hepatocyte growth factor-regulated tyrosine kinase substrate. The interactions with cytoskeletal proteins and a kinase substrate suggest a role for this protein in vesicular trafficking or organelle transport. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74 kDa
NCBI Official Full Name
huntingtin-associated protein 1 isoform 3
NCBI Official Synonym Full Names
huntingtin associated protein 1
NCBI Official Symbol
HAP1
NCBI Official Synonym Symbols
HLP; HAP2; HIP5; hHLP1
NCBI Protein Information
huntingtin-associated protein 1
UniProt Protein Name
Huntingtin-associated protein 1
UniProt Gene Name
HAP1
UniProt Synonym Gene Names
HAP2; HLP1; HAP-1
UniProt Entry Name
HAP1_HUMAN

NCBI Description

Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein that interacts with huntingtin, with two cytoskeletal proteins (dynactin and pericentriolar autoantigen protein 1), and with a hepatocyte growth factor-regulated tyrosine kinase substrate. The interactions with cytoskeletal proteins and a kinase substrate suggest a role for this protein in vesicular trafficking or organelle transport. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HAP1: Associates specifically with huntingtin. This binding is enhanced by an expanded polyglutamine repeat. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 17q21.2-q21.3

Cellular Component: synaptic vesicle; cytoskeleton; mitochondrion; axon; lysosome; endoplasmic reticulum; autophagic vacuole; inclusion body; nucleus; cell junction; actin cytoskeleton

Molecular Function: protein binding; brain-derived neurotrophic factor binding

Biological Process: positive regulation of neurogenesis; positive regulation of inositol-1,4,5-triphosphate receptor activity; exocytosis; nerve growth factor receptor signaling pathway; positive regulation of synaptic transmission, GABAergic; hypothalamus cell differentiation; retrograde axon cargo transport; regulation of exocytosis; synaptic transmission; protein transport; protein localization; cell projection organization and biogenesis; positive regulation of epidermal growth factor receptor signaling pathway; vesicle transport along microtubule; positive regulation of neurotrophin production; autophagy; cerebellum development; brain development; anterograde axon cargo transport

Research Articles on HAP1

Similar Products

Product Notes

The HAP1 hap1 (Catalog #AAA3221252) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAP1 hap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETLPGFQETL AEELRTSLRR MISDPVYFME RNYEMPRGDT SSLRYDFRYS. It is sometimes possible for the material contained within the vial of "HAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.