Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HAND1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit HAND1 Polyclonal Antibody | anti-HAND1 antibody

HAND1 antibody - N-terminal region

Gene Names
HAND1; Hxt; eHand; Thing1; bHLHa27
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HAND1; Polyclonal Antibody; HAND1 antibody - N-terminal region; anti-HAND1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGR
Sequence Length
215
Applicable Applications for anti-HAND1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HAND1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HAND1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-HAND1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-HAND1 antibody
This is a rabbit polyclonal antibody against HAND1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23
NCBI Official Full Name
heart- and neural crest derivatives-expressed protein 1
NCBI Official Synonym Full Names
heart and neural crest derivatives expressed 1
NCBI Official Symbol
HAND1
NCBI Official Synonym Symbols
Hxt; eHand; Thing1; bHLHa27
NCBI Protein Information
heart- and neural crest derivatives-expressed protein 1
UniProt Protein Name
Heart- and neural crest derivatives-expressed protein 1
UniProt Gene Name
HAND1
UniProt Synonym Gene Names
BHLHA27; EHAND; bHLHa27; eHAND
UniProt Entry Name
HAND1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

HAND1: Transcription factor that plays an essential role in both trophoblast-giant cells differentiation and in cardiac morphogenesis. In the adult, could be required for ongoing expression of cardiac-specific genes. Binds the DNA sequence 5'- NRTCTG-3' (non-canonical E-box).

Protein type: Transcription factor; Nucleolus; Cell development/differentiation; DNA-binding

Chromosomal Location of Human Ortholog: 5q33

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; enzyme binding; protein heterodimerization activity; transcription coactivator activity; bHLH transcription factor binding; transcription factor binding; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; blastocyst development; negative regulation of transcription factor activity; heart development; negative regulation of transcription from RNA polymerase II promoter; odontogenesis of dentine-containing teeth; trophectodermal cell differentiation; mesoderm formation; ventricular cardiac muscle morphogenesis; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; heart looping; negative regulation of transcription, DNA-dependent

Research Articles on HAND1

Similar Products

Product Notes

The HAND1 hand1 (Catalog #AAA3201698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAND1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HAND1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAND1 hand1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CHQERPYFQS WLLSPADAAP DFPAGGPPPA AAAAATAYGP DARPGQSPGR. It is sometimes possible for the material contained within the vial of "HAND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.