Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human, Rat HAMP Polyclonal Antibody | anti-HAMP antibody

HAMP antibody - N-terminal region

Gene Names
HAMP; HEPC; PLTR; HFE2B; LEAP1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HAMP; Polyclonal Antibody; HAMP antibody - N-terminal region; anti-HAMP antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
Sequence Length
84
Applicable Applications for anti-HAMP antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HAMP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HAMP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Related Product Information for anti-HAMP antibody
This is a rabbit polyclonal antibody against HAMP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature p

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9kDa
NCBI Official Full Name
hepcidin preproprotein
NCBI Official Synonym Full Names
hepcidin antimicrobial peptide
NCBI Official Symbol
HAMP
NCBI Official Synonym Symbols
HEPC; PLTR; HFE2B; LEAP1
NCBI Protein Information
hepcidin
UniProt Protein Name
Hepcidin
Protein Family
UniProt Gene Name
HAMP
UniProt Synonym Gene Names
HEPC; LEAP1; LEAP-1; PLTR; Hepc25; Hepc20
UniProt Entry Name
HEPC_HUMAN

NCBI Description

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]

Uniprot Description

HAMP: Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. Defects in HAMP are the cause of hemochromatosis type 2B (HFE2B); also known as juvenile hemochromatosis (JH). HFE2B is a disorder of iron metabolism with excess deposition of iron in the tissues, bronze skin pigmentation, hepatic cirrhosis, arthropathy and diabetes. The most common symptoms of hemochromatosis type 2 at presentation are hypogonadism and cardiomyopathy. Belongs to the hepcidin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: apical cortex; extracellular region

Molecular Function: hormone activity

Biological Process: killing of cells of another organism; cellular iron ion homeostasis; defense response to bacterium; immune response; defense response to fungus

Disease: Hemochromatosis, Type 2b

Research Articles on HAMP

Similar Products

Product Notes

The HAMP hamp (Catalog #AAA3205946) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HAMP antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HAMP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAMP hamp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MALSSQIWAA CLLLLLLLAS LTSGSVFPQQ TGQLAELQPQ DRAGARASWM. It is sometimes possible for the material contained within the vial of "HAMP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual