Rabbit anti-Human, Rat HAMP Polyclonal Antibody | anti-HAMP antibody

HAMP antibody - N-terminal region

Cat. Num. AAA3205946

• Gene Names: HAMP; HEPC; PLTR; HFE2B; LEAP1
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: HAMP; Polyclonal Antibody; HAMP antibody - N-terminal region; anti-HAMP antibody

• Host: Rabbit
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWM
• Sequence Length: 84

• Applicable Applications for anti-HAMP antibody: Western Blot (WB)
• Homology: Human: 100%; Rat: 83%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HAMP
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HAMP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Related Product Information for anti-HAMP antibody

This is a rabbit polyclonal antibody against HAMP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature p

Product Categories/Family for anti-HAMP antibody

Polyclonal; Signal Proteins; Lymphocyte Signaling; Growth Factors & Hormones; Membrane Protein; Tissue Specific & Cell Marker; Microbiology

NCBI and Uniprot Product Information

• NCBI GI #: 10863973
• NCBI GeneID: 57817
• NCBI Accession #: NP_066998
• NCBI GenBank Nucleotide #: NM_021175
• UniProt Accession #: P81172
• Molecular Weight: 9kDa
• NCBI Official Full Name: hepcidin preproprotein
• NCBI Official Synonym Full Names: hepcidin antimicrobial peptide
• NCBI Official Symbol: HAMP
• NCBI Official Synonym Symbols: HEPC; PLTR; HFE2B; LEAP1
• NCBI Protein Information: hepcidin
• UniProt Protein Name: Hepcidin
• Protein Family: Hepcidin
• UniProt Gene Name: HAMP
• UniProt Synonym Gene Names: HEPC; LEAP1; LEAP-1; PLTR; Hepc25; Hepc20
• UniProt Entry Name: HEPC_HUMAN

NCBI Description

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]

Uniprot Description

HAMP: Seems to act as a signaling molecule involved in the maintenance of iron homeostasis. Seems to be required in conjunction with HFE to regulate both intestinal iron absorption and iron storage in macrophages. Defects in HAMP are the cause of hemochromatosis type 2B (HFE2B); also known as juvenile hemochromatosis (JH). HFE2B is a disorder of iron metabolism with excess deposition of iron in the tissues, bronze skin pigmentation, hepatic cirrhosis, arthropathy and diabetes. The most common symptoms of hemochromatosis type 2 at presentation are hypogonadism and cardiomyopathy. Belongs to the hepcidin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: apical cortex; extracellular region

Molecular Function: hormone activity

Biological Process: killing of cells of another organism; cellular iron ion homeostasis; defense response to bacterium; immune response; defense response to fungus

Disease: Hemochromatosis, Type 2b