Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in HepG2.)

Rabbit anti-Human HADHB Polyclonal Antibody | anti-HADHB antibody

HADHB (hydroxyacyl-Coenzyme A Dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional Protein), beta Subunit, ECHB, MGC87480, MSTP029, TP-BETA) (HRP)

Gene Names
HADHB; ECHB; MTPB; MSTP029; TP-BETA
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
HADHB; Polyclonal Antibody; HADHB (hydroxyacyl-Coenzyme A Dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional Protein); beta Subunit; ECHB; MGC87480; MSTP029; TP-BETA) (HRP); hydroxyacyl-Coenzyme A Dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional Protein); TP-BETA; anti-HADHB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HADHB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-HADHB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HADHB (NP_000174.1, 1aa-474aa) full-length human protein.
Immunogen Sequence
MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRL FAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVM NRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.

Western Blot (WB)

(HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in HepG2.)

Western Blot (WB) (HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in HepG2.)

Western Blot (WB)

(HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in Hela S3 NE.)

Western Blot (WB) (HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in Hela S3 NE.)

Western Blot (WB)

(HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in human colon.)

Western Blot (WB) (HADHB MaxPab rabbit polyclonal antibody. Western Blot analysis of HADHB expression in human colon.)
Product Categories/Family for anti-HADHB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,880 Da
NCBI Official Full Name
trifunctional enzyme subunit beta, mitochondrial isoform 1
NCBI Official Synonym Full Names
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit
NCBI Official Symbol
HADHB
NCBI Official Synonym Symbols
ECHB; MTPB; MSTP029; TP-BETA
NCBI Protein Information
trifunctional enzyme subunit beta, mitochondrial
UniProt Protein Name
Trifunctional enzyme subunit beta, mitochondrial
Protein Family
UniProt Gene Name
HADHB
UniProt Entry Name
ECHB_HUMAN

Uniprot Description

HADHB: Defects in HADHB are a cause of trifunctional protein deficiency (TFP deficiency). The clinical manifestations are very variable and include hypoglycemia, cardiomyopathy and sudden death. Phenotypes with mainly hepatic and neuromyopathic involvement can also be distinguished. Biochemically, TFP deficiency is defined by the loss of all three enzyme activities of the TFP complex. Belongs to the thiolase family.

Protein type: Amino Acid Metabolism - valine, leucine and isoleucine degradation; EC 2.3.1.16; Lipid Metabolism - fatty acid; Lipid Metabolism - fatty acid elongation in mitochondria; Transferase

Chromosomal Location of Human Ortholog: 2p23

Cellular Component: endoplasmic reticulum; mitochondrial envelope; mitochondrial inner membrane; mitochondrial outer membrane

Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity; enoyl-CoA hydratase activity; protein binding

Biological Process: fatty acid beta-oxidation

Disease: Trifunctional Protein Deficiency

Similar Products

Product Notes

The HADHB hadhb (Catalog #AAA6451062) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HADHB (hydroxyacyl-Coenzyme A Dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional Protein), beta Subunit, ECHB, MGC87480, MSTP029, TP-BETA) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HADHB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HADHB hadhb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HADHB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.